| Rank | PDB hit | ID1 | ID2 | Cov | Norm. Zscore | Threadingprogram | | 20 40
| | |
| Seq | AMLIALIVICLIVIVTALVTRKDLCEVRIRTGQTEVAVFTA |
| 1 | 4exrA2 | 0.07 | 0.07 | 2.98 | 1.06 | SPARKS-K | | EIALKEQNGIVKEWSLDKDLDVTFYKIRIDKDKNEYDIKVD |
| 2 | 2rddB | 0.14 | 0.12 | 4.15 | 1.30 | MUSTER | | PMSLILMLVVFGLIFYFMILRPQ------QKRTKEHKKLMD |
| 3 | 2vqcA | 0.12 | 0.12 | 4.27 | 0.91 | SPARKS-K | | EISVPSAYNIQRALKAICERHPDECEVQYKNRKTTFKWIK- |
| 4 | 1uspA | 0.10 | 0.10 | 3.59 | 0.27 | FFAS-3D | | -LFAAGYAACFQGALGVVSRRQKIDGLQKAGLAFALDVEL- |
| 5 | 5kzfA3 | 0.26 | 0.17 | 5.27 | 0.25 | HHpred | | ------------EKVVDRMYDNRFLEVTYANGDKEVMYF-- |
| 6 | 2metA | 0.11 | 0.10 | 3.49 | 1.20 | MUSTER | | TNLEIIILEGTAVIAMFFWLLLVIILRTVKRANGG------ |
| 7 | 2c1wA | 0.05 | 0.05 | 2.32 | 0.51 | CNFpred | | SFIGVSPEFEFALYTIVFLASEKMSREVVRLEEYELQIVVN |
| 8 | 4hg6B | 0.13 | 0.07 | 2.54 | 0.33 | HHsearch-2 | | LGGMLGLAWISAAIAVGFVLRTR------------------ |
| 9 | 2vqcA | 0.12 | 0.12 | 4.27 | 0.86 | Neff-PPAS | | EISVPSAYNIQRALKAICERHPDECEVQYKNRKTTFKWIK- |
| 10 | 4ksnA | 0.22 | 0.12 | 3.85 | 0.44 | HHsearch | | -----------------DTHLADLYLLKYDTGLGVYESFI- |
| (a) | ID1 is the number of template residues identical to query divided by number of aligned residues. |
| (b) | ID2 is the number of template residues identical to query divided by query sequence length. |
| (c) | Cov is equal the number of aligned template residues divided by query sequence length. |
| (d) | Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold. |
| (e) | Threading program lists the threading program used to identify the template. |
| (f) | Template residues identical to query sequence are highlighted in color. |
|