| Rank | PDB hit | ID1 | ID2 | Cov | Norm. Zscore | Threadingprogram | | 20 40
| | |
| Seq | DSSEEKFLRRIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQY |
| 1 | 4owtC | 0.16 | 0.15 | 4.85 | 1.03 | SPARKS-K | | AAQQKAALQHAHAHSSGYFITQDSAFGN-LILPVLPRL--- |
| 2 | 2kkgA | 0.33 | 0.24 | 7.32 | 1.16 | MUSTER | | ----------WGQHGGGWGPHGGGWGQPGWGQPHGGGWGQ- |
| 3 | 3kc4U | 0.20 | 0.20 | 6.27 | 1.15 | Neff-PPAS | | NEPFDVALRRFKRSCEKAGVLAEVRRREFYEKPTTERKRAK |
| 4 | 1m0fB | 0.12 | 0.12 | 4.29 | 0.99 | SPARKS-K | | KKRDEIEAGKSYCSRGGATIYARFDKNDWRIQPAEFYRFHD |
| 5 | 5myjAU | 0.23 | 0.22 | 6.90 | 0.33 | FFAS-3D | | NESLDDALRRFKRSVTKAGTLQELRKREHYEKPSVKRKRK- |
| 6 | 3a58A2 | 0.17 | 0.12 | 4.00 | 0.21 | HHpred | | NSAKERFIKSLIQTFEGHVPELNWDLSLF------------ |
| 7 | 4a54B | 0.15 | 0.15 | 4.93 | 1.15 | MUSTER | | DVDADASSQLLSLLKSSTAPSDATPQPSTFPQPPVESHSS- |
| 8 | 3a4kA | 0.27 | 0.10 | 3.00 | 0.39 | CNFpred | | SSTQEKLFSKAGDIV-------------------------- |
| 9 | 1diqA2 | 0.24 | 0.12 | 3.80 | 0.35 | HHsearch-2 | | TNPEETCFNELLDEKEGYAVY-------------------- |
| 10 | 2aw7U | 0.20 | 0.20 | 6.27 | 1.08 | Neff-PPAS | | NEPFDVALRRFKRSCEKAGVLAEVRRREFYEKPTTERKRAK |
| (a) | ID1 is the number of template residues identical to query divided by number of aligned residues. |
| (b) | ID2 is the number of template residues identical to query divided by query sequence length. |
| (c) | Cov is equal the number of aligned template residues divided by query sequence length. |
| (d) | Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold. |
| (e) | Threading program lists the threading program used to identify the template. |
| (f) | Template residues identical to query sequence are highlighted in color. |
|