| Rank | PDB hit | ID1 | ID2 | Cov | Norm. Zscore | Threadingprogram | | 20 40
| | |
| Seq | VPCAWAGNVCGEKRAYCCSDPGRYCPWQVVCYESSEICSKKCG |
| 1 | 2bbgA | 0.46 | 0.42 | 12.21 | 4.10 | SPARKS-K | | DGLCYEGTNCGKVGKYCCSPIGKYC----VCYDSKAICNKNCT |
| 2 | 2bbgA | 0.50 | 0.42 | 12.14 | 0.63 | FFAS-3D | | ---CYEGTNCGKVGKYCCSPIGKYC----VCYDSKAICNKNCT |
| 3 | 2bbgA | 0.50 | 0.44 | 12.81 | 1.48 | HHpred | | GLC-YEGTNCGKVGKYCCSPIGKYC----VCYDSKAICNKNCT |
| 4 | 2bbgA | 0.50 | 0.44 | 12.81 | 3.39 | MUSTER | | GLC-YEGTNCGKVGKYCCSPIGKYC----VCYDSKAICNKNCT |
| 5 | 1bbgA | 0.43 | 0.37 | 10.91 | 1.57 | CNFpred | | --LCYEGTNCGKVGKYCCSPIGK----YCVCYDSKAICNKNCT |
| 6 | 2bbgA | 0.50 | 0.44 | 12.81 | 2.84 | HHsearch-2 | | GLC-YEGTNCGKVGKYCCSPIGKYC----VCYDSKAICNKNCT |
| 7 | 2bbgA | 0.50 | 0.42 | 12.14 | 4.75 | Neff-PPAS | | ---CYEGTNCGKVGKYCCSPIGKYC----VCYDSKAICNKNCT |
| 8 | 2bbgA | 0.51 | 0.44 | 12.79 | 4.02 | HHsearch | | GLC-YEGTNCGKVGKYCCSPIGKYC----VCYDSKAICNKNC- |
| 9 | 2bbg | 0.46 | 0.42 | 12.21 | 0.56 | PROSPECTOR2 | | DDLCYEGTNCGKVGKYCCSPIGKYC----VCYDSKAICNKNCT |
| 10 | 2bbgA | 0.51 | 0.42 | 12.12 | 0.41 | SAM | | ----YEGTNCGKVGKYCCSPIGKYC----VCYDSKAICNKNCT |
| (a) | ID1 is the number of template residues identical to query divided by number of aligned residues. |
| (b) | ID2 is the number of template residues identical to query divided by query sequence length. |
| (c) | Cov is equal the number of aligned template residues divided by query sequence length. |
| (d) | Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold. |
| (e) | Threading program lists the threading program used to identify the template. |
| (f) | Template residues identical to query sequence are highlighted in color. |
|