| Rank | PDB hit | ID1 | ID2 | Cov | Norm. Zscore | Threadingprogram | | 20 40
| | |
| Seq | HAQPRHPAVYSPAAGVLCDRYVCADDQGISRALTERYLGK |
| 1 | 2kyjA | 0.13 | 0.10 | 3.45 | 1.52 | SPARKS-K | | PLSKEYESCVRPRPPLKCNKAICVDPNKGW---------- |
| 2 | 1vzmA | 0.26 | 0.23 | 6.92 | 1.36 | MUSTER | | -----KELTLAQTSLRVCTNMACADAQGI-VAAYQAFYGP |
| 3 | 2bbgA | 0.22 | 0.17 | 5.53 | 1.30 | Neff-PPAS | | TNCGKVGKYCCSPIGKYC---VCYD----SKAICNKNCT- |
| 4 | 1icfI | 0.25 | 0.23 | 6.97 | 1.22 | SPARKS-K | | HIPAVHPGSFRPK----CDECWCVFPNGTEVPNTRSRGHH |
| 5 | 3c7uB2 | 0.23 | 0.17 | 5.47 | 0.24 | FFAS-3D | | ----------APSAPTLTLAKFNQVTVGMTRAQVLATVGQ |
| 6 | 1riqA2 | 0.14 | 0.10 | 3.40 | 0.24 | HHpred | | ------------GRKTLSGKETAYDTYGFPVDLIDEIARE |
| 7 | 1xv3A | 0.17 | 0.17 | 5.72 | 1.20 | MUSTER | | HSSGYTRPLRKPSRPIFIRPIGCDVCYGIPARLCCFRYGD |
| 8 | 2bpoA | 0.27 | 0.15 | 4.60 | 0.60 | CNFpred | | ------------------FIYVCGDAKGMAKGVSTALVGI |
| 9 | 6e9eA | 0.15 | 0.15 | 5.05 | 0.34 | HHsearch-2 | | RGETVSAVTDNPLRRFNGRKPVPTDMLCLKPTLEKKFFGK |
| 10 | 1ohmA | 0.21 | 0.15 | 4.75 | 1.25 | Neff-PPAS | | ------------GNGVHCGKHSCTVDWGTAIGCIGNNAAA |
| (a) | ID1 is the number of template residues identical to query divided by number of aligned residues. |
| (b) | ID2 is the number of template residues identical to query divided by query sequence length. |
| (c) | Cov is equal the number of aligned template residues divided by query sequence length. |
| (d) | Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold. |
| (e) | Threading program lists the threading program used to identify the template. |
| (f) | Template residues identical to query sequence are highlighted in color. |
|