| Rank | PDB hit | ID1 | ID2 | Cov | Norm. Zscore | Threadingprogram | | 20 40
| | |
| Seq | CGSTPPVQVPCVKPPAPPAWIMQPAPDWQTPLNGIISSSER |
| 1 | 2n71A | 0.11 | 0.10 | 3.54 | 1.00 | SPARKS-K | | CVG----RKACTREWYPVCGVTYSNPCNFSAQQEQCDPNIT |
| 2 | 3zf7w1 | 0.07 | 0.07 | 2.95 | 1.15 | Neff-PPAS | | -MFMTGLILLGKGREVMPAKAVPAPESAIKRAAFKQQQTEN |
| 3 | 3gawA2 | 0.12 | 0.12 | 4.29 | 0.99 | SPARKS-K | | CGPPPELLNKEKTKEEYEVVEYYCNPRFLMKGPNKIQVDGE |
| 4 | 1q3yA | 0.13 | 0.10 | 3.37 | 0.22 | FFAS-3D | | CGKEGHTARNHRAPRKKGCWKCGKEGHQMK----------- |
| 5 | 2lh0A | 0.00 | 0.00 | 0.66 | 0.23 | HHpred | | --------------MMSKLFLDELPESLSRKIGTVVRVLPS |
| 6 | 4nl6A | 0.12 | 0.12 | 4.29 | 0.77 | MUSTER | | NIKPKSAPWNSFLPPPPPMPGPRLGPGKPGLKFNGPPPPPP |
| 7 | 5da9A | 0.13 | 0.07 | 2.54 | 0.64 | CNFpred | | ------------------LWPMSEPAALKKRFDEIFEAQKY |
| 8 | 4kmaA | 0.16 | 0.15 | 4.85 | 0.42 | HHsearch-2 | | KTEIELKQIENPKPQRPPTWPAN----LLQAIGRYCFQTGN |
| 9 | 1zvoC2 | 0.08 | 0.07 | 2.88 | 1.14 | Neff-PPAS | | -ATTAPATTRNTGRGGEE---KKKEKEKEEQEERETKTPEC |
| 10 | 2lh0A | 0.00 | 0.00 | 0.68 | 0.37 | HHsearch | | ------------GHMMSKLFLDELPESLSRKIGTVVRVLP- |
| (a) | ID1 is the number of template residues identical to query divided by number of aligned residues. |
| (b) | ID2 is the number of template residues identical to query divided by query sequence length. |
| (c) | Cov is equal the number of aligned template residues divided by query sequence length. |
| (d) | Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold. |
| (e) | Threading program lists the threading program used to identify the template. |
| (f) | Template residues identical to query sequence are highlighted in color. |
|