| Rank | PDB hit | ID1 | ID2 | Cov | Norm. Zscore | Threadingprogram | | 20 40
| | |
| Seq | NHQALMAAQSKAVIARFLGDAGMWLQANQQMKQAVSMPWYRR |
| 1 | 5an3A2 | 0.10 | 0.10 | 3.52 | 1.12 | SPARKS-K | | DRSKIGLVNFRYFVHFFNIKD--YELAQSYFKKAKNLGYVDD |
| 2 | 4a1sA5 | 0.24 | 0.21 | 6.69 | 1.46 | MUSTER | | DLRTLSAIYSQLGNAYFY--LGDYNKAMQYHKHDLTL--AKS |
| 3 | 4a1sA5 | 0.24 | 0.21 | 6.69 | 1.02 | SP3 | | DLRTLSAIYSQLGNAYFY--LGDYNKAMQYHKHDLTL--AKS |
| 4 | 4wheA1 | 0.12 | 0.12 | 4.21 | 0.93 | SPARKS-K | | ASAREVEWQEKAELALLKEREDLARAALIEKQKLTDLIKSLE |
| 5 | 4b4tR2 | 0.15 | 0.14 | 4.79 | 0.50 | FFAS-3D | | ---KIDVMLTIARLGFFYNDQLYVKEKLEAVNSMIGGDWERR |
| 6 | 3evlA2 | 0.16 | 0.14 | 4.76 | 0.37 | HHpred | | NNASYWRGQEATIIGVISKDDELFRWGLGRYVQAMGLI---- |
| 7 | 4gcnA2 | 0.17 | 0.17 | 5.45 | 1.28 | MUSTER | | DYKLIAKAMSRAGNAFQK--QNDLSLAVQWFHRSLSEFRDPE |
| 8 | 1hv6A | 0.17 | 0.14 | 4.71 | 0.57 | CNFpred | | NNHSYWRGQEATIIGVISKDDELFRWGLGRYVQAMG------ |
| 9 | 5o09C | 0.12 | 0.12 | 4.17 | 0.43 | HHsearch-2 | | QDPDLTGIYSLLAHL--YDRWGRMDKAAEFYELALKISAENG |
| 10 | 3sf4A4 | 0.22 | 0.21 | 6.76 | 0.99 | Neff-PPAS | | -DQAMHFAEKHLEISREVGDKSGELTARLNLSDLQMVLGLSY |
| (a) | ID1 is the number of template residues identical to query divided by number of aligned residues. |
| (b) | ID2 is the number of template residues identical to query divided by query sequence length. |
| (c) | Cov is equal the number of aligned template residues divided by query sequence length. |
| (d) | Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold. |
| (e) | Threading program lists the threading program used to identify the template. |
| (f) | Template residues identical to query sequence are highlighted in color. |
|