| Rank | PDB hit | ID1 | ID2 | Cov | Norm. Zscore | Threadingprogram | | 20 40 60 80 100
| | | | | |
| Seq | RKSWSTCKPFFTGLNYCFTGAYSNASSTDSASYYPLTGDTRFELELQPTGEIEQYSASATYELQREDRALVDTLKFVTQAEGVKQTEATMMFKYNRQSMTLSSEVQIPNFDI |
| 1 | 1lshA | 0.23 | 0.12 | 3.93 | 1.34 | HHpred | | MRRKQSCSKSALSSKVCFSARLRNAAFIRNALLYKITGDYVSKVYVQPTKAITKVELELQAG-------------------------------------------------- |
| 2 | 1lshA | 0.23 | 0.12 | 3.93 | 2.49 | HHsearch-2 | | MRRKQSCSKSALSSKVCFSARLRNAAFIRNALLYKITGDYVSKVYVQPTKAITKVELELQAG-------------------------------------------------- |
| 3 | 1lshA4 | 0.23 | 0.12 | 3.93 | 2.90 | HHsearch | | MRRKQSCSKSALSSKVCFSARLRNAAFIRNALLYKITGDYVSKVYVQPTKAITKVELELQAG-------------------------------------------------- |
| 4 | 1lshA4 | 0.24 | 0.12 | 3.89 | 1.07 | FFAS03 | | --RKQSCSKSALSSKVCFSARLRNAAFIRNALLYKITGDYVSKVYVQPTSSITKVELELQ---------------------------------------------------- |
| 5 | 1lshA4 | 0.23 | 0.12 | 3.93 | 1.21 | HHpred | | MRRKQSCSKSALSSKVCFSARLRNAAFIRNALLYKITGDYVSKVYVQPTKAITKVELELQAG-------------------------------------------------- |
| 6 | 1lshA4 | 0.23 | 0.12 | 3.93 | 2.25 | HHsearch-2 | | MRRKQSCSKSALSSKVCFSARLRNAAFIRNALLYKITGDYVSKVYVQPTKAITKVELELQAG-------------------------------------------------- |
| 7 | 1lshA | 0.23 | 0.12 | 3.93 | 2.90 | HHsearch | | MRRKQSCSKSALSSKVCFSARLRNAAFIRNALLYKITGDYVSKVYVQPTKAITKVELELQAG-------------------------------------------------- |
| 8 | 1opoC2 | 0.12 | 0.11 | 3.76 | 0.72 | SPARKS-K | | ------KISQASNDKVSDGPTYVVPSVNGNELQLRVVAAGKWCIIVRGTVEFTKPTLIISGDVDYESARPIAVCELVTQMEG-----QILKITKTSAEQPLQWVVYRM---- |
| 9 | 1lshA4 | 0.23 | 0.12 | 3.91 | 0.65 | FFAS-3D | | MRRKQSCSKSALSSKVCFSARLRNAAFIRNALLYKITGDYVSKVYVQPTSQITKVELELQ---------------------------------------------------- |
| 10 | 5a1wH3 | 0.10 | 0.06 | 2.31 | 0.33 | HHpred | | ----------------------------------------PLTINCWPSESGNGCDVNIEYELQEDNLE-LNDVVITIPLPSGVAPVIDGEYRHDSRRNTLEWCLPVIDAK- |
| (a) | ID1 is the number of template residues identical to query divided by number of aligned residues. |
| (b) | ID2 is the number of template residues identical to query divided by query sequence length. |
| (c) | Cov is equal the number of aligned template residues divided by query sequence length. |
| (d) | Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold. |
| (e) | Threading program lists the threading program used to identify the template. |
| (f) | Template residues identical to query sequence are highlighted in color. |
|