| Rank | PDB hit | ID1 | ID2 | Cov | Norm. Zscore | Threadingprogram | | 20 40
| | |
| Seq | LILSLENSTDKITIAGYFQNDGITPYALEQIRFADGTTWNLD |
| 1 | 5cxlA | 0.13 | 0.12 | 4.12 | 1.07 | MUSTER | | LEIRILGTDDALTVHDWYRD---ADHRVEIIHA-ANQAVDQA |
| 2 | 5cxlA | 0.16 | 0.14 | 4.74 | 1.10 | HHsearch | | LEIRILGTDDALTVHDWYRDA---DHRVEII-HAANQAVDQ- |
| 3 | 3p4gA1 | 0.07 | 0.07 | 2.93 | 0.78 | SPARKS-K | | IGSAFDASNNNVAVTGNVSATLNVLAGDDKVSIDGNVEDVLV |
| 4 | 5cxlA | 0.16 | 0.14 | 4.74 | 0.40 | FFAS-3D | | LEIRILGTDDALTVHDWYRD---ADHRVEIIHAANQAVDQ-- |
| 5 | 5cxlA | 0.16 | 0.14 | 4.76 | 0.68 | HHpred | | LEIRILGTDDALTVHDWYRDA---DHRVEII-HAANQAVDQA |
| 6 | 4gqaA2 | 0.10 | 0.10 | 3.55 | 0.66 | MUSTER | | CLVNFDS-GAAGVIEASRIAAGRIFGVFWEVSGTEGTLYDGE |
| 7 | 5cvwA | 0.16 | 0.14 | 4.76 | 0.64 | CNFpred | | LEIRILGTDDALTVHDWYRDA---DHRVEIIHAA-NQAVDQA |
| 8 | 5cxlA | 0.16 | 0.14 | 4.76 | 0.83 | HHsearch-2 | | LEIRILGTDDALTVHDWYRDA---DHRVEII-HAANQAVDQA |
| 9 | 5n76A | 0.10 | 0.10 | 3.57 | 0.84 | Neff-PPAS | | DVLEVRAEGGAVRVTTLFDEEHAPGLAIGRVDLRSGVISLIE |
| 10 | 5ttaA | 0.15 | 0.14 | 4.79 | 0.58 | HHsearch | | KQNAIAP-GKN-QNDAFLLFTGEIISCVKQVTFNDGSVWKN- |
| (a) | ID1 is the number of template residues identical to query divided by number of aligned residues. |
| (b) | ID2 is the number of template residues identical to query divided by query sequence length. |
| (c) | Cov is equal the number of aligned template residues divided by query sequence length. |
| (d) | Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold. |
| (e) | Threading program lists the threading program used to identify the template. |
| (f) | Template residues identical to query sequence are highlighted in color. |
|