| Rank | PDB hit | ID1 | ID2 | Cov | Norm. Zscore | Threadingprogram | | 20 40
| | |
| Seq | EPQEQELHLGQKQKQKLHEPELQLGKQQHQKPSEPELPLGK |
| 1 | 2mxrA | 0.15 | 0.15 | 4.90 | 1.35 | SPARKS-K | | EQILAENEKLKAQLHDTNMELTDLKLQLEKATQRQERFA-- |
| 2 | 2l2lA | 0.29 | 0.29 | 8.90 | 1.41 | MUSTER | | SPEERERMIKQLKEERLEEAKLVLLKKLRQSQIQKEATAQK |
| 3 | 2h8nA | 0.24 | 0.24 | 7.59 | 1.05 | CNFpred | | QLQQELLALKQKQQIQRQILIAEFQRQHEQLSRQHEAQLHE |
| 4 | 5xiuA | 0.23 | 0.22 | 6.90 | 1.40 | Neff-PPAS | | -GHMEETEINFTQKLIDLEHLLFERHKQEEQDRLLALQLQK |
| 5 | 4gdoA | 0.14 | 0.12 | 4.20 | 1.28 | SPARKS-K | | EERERLAEVEAALEKQRQLAEAHAQAKAQAEREAKEL---- |
| 6 | 5gaoE | 0.35 | 0.17 | 5.10 | 0.33 | FFAS-3D | | -TKEA----YKKLSQKFH------GTKSNKK---------- |
| 7 | 2ko6A | 0.29 | 0.15 | 4.46 | 0.17 | HHpred | | ----------------QKEPDFNLLQFLQKLAKEGEL---- |
| 8 | 1psmA | 0.19 | 0.17 | 5.51 | 1.33 | MUSTER | | EAYKKAKQASQDAEQAAKDAE-NASKEAEEAAKEAVLK--- |
| 9 | 2o94A | 0.24 | 0.24 | 7.59 | 0.99 | CNFpred | | QLQQELLALKQKQQIQRQILIAEFQRQFEQLSRQHEAQLHE |
| 10 | 3msvA3 | 0.30 | 0.15 | 4.44 | 0.49 | HHsearch-2 | | ---------------------ASLKKQQQLEKQKQEAELSN |
| (a) | ID1 is the number of template residues identical to query divided by number of aligned residues. |
| (b) | ID2 is the number of template residues identical to query divided by query sequence length. |
| (c) | Cov is equal the number of aligned template residues divided by query sequence length. |
| (d) | Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold. |
| (e) | Threading program lists the threading program used to identify the template. |
| (f) | Template residues identical to query sequence are highlighted in color. |
|