| Rank | PDB hit | ID1 | ID2 | Cov | Norm. Zscore | Threadingprogram | | 20 40
| | |
| Seq | EAEKRKAAEATKVAEAEKQKAAEATKVAEAEKQKAAEATKVA |
| 1 | 6exnD2 | 0.07 | 0.07 | 2.93 | 1.55 | SPARKS-K | | LENLRKKNLEMSQRAEMINRSKHAQQEKAVTTDDLDNLVDQV |
| 2 | 3zf7T3 | 0.20 | 0.19 | 6.12 | 1.66 | MUSTER | | AAKRLKDEQNRRKARKQELKKREKERERARRDDAAAAAAAK- |
| 3 | 3zf7T3 | 0.20 | 0.19 | 6.10 | 1.24 | Neff-PPAS | | --AAKRLKDEQNRRKARKQELKKREKERERARRDDAAAAAAA |
| 4 | 5yfpE8 | 0.07 | 0.07 | 2.93 | 1.17 | SPARKS-K | | QVATQEVIHSENVIKLSKDLHTTLLTFDKLDDRLTNVTQVVS |
| 5 | 2tmaA3 | 0.20 | 0.19 | 6.12 | 0.59 | FFAS-3D | | DADRKEVARKLVIIESDLERAEERAELSEGKCAELEEEIKT- |
| 6 | 2b5uA | 0.18 | 0.17 | 5.43 | 0.20 | HHpred | | DQVKQRQDEENRAAERNYERARAELNQANEDVARNQERQ--- |
| 7 | 1kilE | 0.23 | 0.21 | 6.74 | 1.48 | MUSTER | | --KKEEERQEALRQAEEERKAKYAKMEAEREVMRQGIRDKYG |
| 8 | 5dfzD | 0.07 | 0.07 | 2.93 | 0.45 | CNFpred | | KKEEERLLDQLLRLEMTDDDLDGELVRLQEKKVQLENEKLQK |
| 9 | 2qzvA | 0.20 | 0.19 | 6.10 | 0.56 | HHsearch-2 | | KHEAQRLEQEA-RGRLERQKILDQ-SEAEKARKELLELEAMA |
| 10 | 6exnD2 | 0.10 | 0.10 | 3.55 | 1.22 | Neff-PPAS | | -LENLRKKNLEMSQRAEMINRSKHAQQEKAVTTDDLDNLVDQ |
| (a) | ID1 is the number of template residues identical to query divided by number of aligned residues. |
| (b) | ID2 is the number of template residues identical to query divided by query sequence length. |
| (c) | Cov is equal the number of aligned template residues divided by query sequence length. |
| (d) | Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold. |
| (e) | Threading program lists the threading program used to identify the template. |
| (f) | Template residues identical to query sequence are highlighted in color. |
|