| Rank | PDB hit | ID1 | ID2 | Cov | Norm. Zscore | Threadingprogram | | 20 40
| | |
| Seq | IPVYLYTYSEGSLKDNYIKFESINKLSQYLNISRETINIYL |
| 1 | 1u3eM2 | 0.14 | 0.12 | 4.17 | 1.23 | SPARKS-K | | KPIIVIS-----PDGIEKEYPSTKCACEELGLTRGKVTDVL |
| 2 | 1u3eM2 | 0.14 | 0.12 | 4.17 | 1.23 | MUSTER | | KPIIVIS-----PDGIEKEYPSTKCACEELGLTRGKVTDVL |
| 3 | 1u3eM2 | 0.14 | 0.12 | 4.17 | 1.39 | Neff-PPAS | | KPIIVIS-----PDGIEKEYPSTKCACEELGLTRGKVTDVL |
| 4 | 1gdtA2 | 0.13 | 0.12 | 4.24 | 1.19 | SPARKS-K | | --GRKRKIDRDAVLNMWQQGLGASHISKTMNIARSTVYKVI |
| 5 | 1i3jA | 0.12 | 0.07 | 2.56 | 0.35 | FFAS-3D | | -----------------VIFDCAADAARHFKISSGLVTYRV |
| 6 | 1u3eM2 | 0.14 | 0.12 | 4.17 | 0.52 | HHpred | | KPIIVIS-----PDGIEKEYPSTKCACEELGLTRGKVTDVL |
| 7 | 4l5eA | 0.12 | 0.12 | 4.27 | 1.23 | MUSTER | | -HKSIKEIEKEEIIKVLKEVFNKKLASEILGIPLRTLYKRL |
| 8 | 1i3jA | 0.14 | 0.07 | 2.51 | 0.60 | CNFpred | | -------------------FDCAADAARHFKISSGLVTYRV |
| 9 | 1u3eM2 | 0.14 | 0.12 | 4.17 | 0.45 | HHsearch-2 | | KPIIVIS-PD----GIEKEYPSTKCACEELGLTRGKVTDVL |
| 10 | 1gdtA2 | 0.24 | 0.12 | 3.80 | 1.06 | Neff-PPAS | | --------------------LGASHISKTMNIARSTVYKVI |
| (a) | ID1 is the number of template residues identical to query divided by number of aligned residues. |
| (b) | ID2 is the number of template residues identical to query divided by query sequence length. |
| (c) | Cov is equal the number of aligned template residues divided by query sequence length. |
| (d) | Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold. |
| (e) | Threading program lists the threading program used to identify the template. |
| (f) | Template residues identical to query sequence are highlighted in color. |
|