| Rank | PDB hit | ID1 | ID2 | Cov | Norm. Zscore | Threadingprogram | | 20 40
| | |
| Seq | METEQPEETFPNTETNGEFGKRPAEDMEEEQAFKRSRNTDEMV |
| 1 | 1zvoC2 | 0.20 | 0.19 | 5.95 | 1.19 | SPARKS-K | | -GSLAKATTAPATTRNTGGEEKKKEKEKEEQEERETKTPEC-- |
| 2 | 1zvoC2 | 0.19 | 0.19 | 6.00 | 1.46 | MUSTER | | GSLAKATTAPATTRNTGRGGEEKKKEKEKEEQEERETKTPEC- |
| 3 | 6od2A | 0.16 | 0.16 | 5.40 | 1.14 | Neff-PPAS | | DDDIYESAELKRVEEEIEELKRKILVRKKHDLRKLSLNNQLQE |
| 4 | 6exnD2 | 0.05 | 0.05 | 2.14 | 1.14 | SPARKS-K | | -----LENLRKKNLEMSQRAEMINRSKHAQQEKAVTTDDLDNL |
| 5 | 5awwG | 0.06 | 0.05 | 2.02 | 0.24 | FFAS-3D | | VQEPKQGAGDLMGGSADLFSARGVTGGLYRLTV---------- |
| 6 | 3kycB3 | 0.27 | 0.23 | 7.14 | 0.26 | HHpred | | --DLGKDVEFEVV---GERRKRKLDE-KENLSAKRSRIEQDVI |
| 7 | 2rvbA | 0.31 | 0.26 | 7.74 | 1.10 | MUSTER | | DSNEEEEESENDWEEVEELSEPVLGDVRESTAFSRS------- |
| 8 | 2rvbA | 0.40 | 0.14 | 4.12 | 0.73 | CNFpred | | ---------------------PVLGDVRESTAFSRS------- |
| 9 | 3feyA1 | 0.17 | 0.09 | 3.07 | 0.47 | HHsearch-2 | | --------------SR----RRHSDENDGGQPHKRRKTS-DAN |
| 10 | 2x7aA | 0.19 | 0.19 | 6.02 | 1.13 | Neff-PPAS | | AEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSV |
| (a) | ID1 is the number of template residues identical to query divided by number of aligned residues. |
| (b) | ID2 is the number of template residues identical to query divided by query sequence length. |
| (c) | Cov is equal the number of aligned template residues divided by query sequence length. |
| (d) | Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold. |
| (e) | Threading program lists the threading program used to identify the template. |
| (f) | Template residues identical to query sequence are highlighted in color. |
|