| Rank | PDB hit | ID1 | ID2 | Cov | Norm. Zscore | Threadingprogram | | 20 40
| | |
| Seq | FEIIKKNYERGLWSKQMVATAVRKGVITAEQYREITGEDY |
| 1 | 2xf5A | 0.21 | 0.20 | 6.35 | 1.65 | SPARKS-K | | YGYFLDSWLDGTASEER--VAVNAGDLTQEEADKISYPWG |
| 2 | 2xf5A | 0.21 | 0.20 | 6.35 | 2.11 | MUSTER | | YGYFLDSWLDGTAS--EERVAVNAGDLTQEEADKISYPWW |
| 3 | 2xf5A | 0.18 | 0.17 | 5.67 | 1.56 | Neff-PPAS | | YGYFLDSWLDGTA--SEERVAVNAGDLTQEEADKISYPWG |
| 4 | 2xf5A | 0.19 | 0.17 | 5.65 | 1.46 | HHsearch | | YGYFLDSWLDGTA--SEERVAVNAGDLTQEEADKISYPW- |
| 5 | 2p6jA | 0.15 | 0.15 | 5.05 | 1.22 | SPARKS-K | | EEKLKEFVKRHQITQEELHQYAQRLGLNEEAIRQFFEEFE |
| 6 | 2xf5A | 0.24 | 0.20 | 6.25 | 0.52 | FFAS-3D | | YGYFLDSWLDGTAS--EERVAVNAGDLTQEEADKIS---- |
| 7 | 1kqgA | 0.15 | 0.15 | 5.05 | 0.28 | HHpred | | SGVLRYLIENNKINAEYVKHYTNAGRYTPDVVENICGTPK |
| 8 | 5vidF | 0.24 | 0.23 | 7.00 | 1.41 | MUSTER | | ELKAKFFLEIG--DRDAARNALRKAGYSDEEAERII-RKY |
| 9 | 2xf5A | 0.23 | 0.23 | 7.08 | 0.87 | CNFpred | | YGYFLDSWLDGTASEEMMRVAVNAGDLTQEEADKIMSYPW |
| 10 | 2xf5A | 0.18 | 0.17 | 5.67 | 0.82 | HHsearch-2 | | YGYFLDSWLDGTA--SEERVAVNAGDLTQEEADKISYPWG |
| (a) | ID1 is the number of template residues identical to query divided by number of aligned residues. |
| (b) | ID2 is the number of template residues identical to query divided by query sequence length. |
| (c) | Cov is equal the number of aligned template residues divided by query sequence length. |
| (d) | Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold. |
| (e) | Threading program lists the threading program used to identify the template. |
| (f) | Template residues identical to query sequence are highlighted in color. |
|