| Rank | PDB hit | ID1 | ID2 | Cov | Norm. Zscore | Threadingprogram | | 20 40
| | |
| Seq | VVKPGSYVLCAVTGEPIPLEELRYWSVDRQEPYASPEIATQR |
| 1 | 5fvmC4 | 0.08 | 0.07 | 2.81 | 1.10 | SPARKS-K | | FQQENRWMVSSSEDGTIKV-----WDVRSPSVQRNYKHNAPV |
| 2 | 5w1sM | 0.21 | 0.19 | 6.07 | 1.08 | MUSTER | | NAHGIPVYLCEACGNPIPEARRTL-CVECQAYQ--RQRKHYA |
| 3 | 3o70A | 0.10 | 0.10 | 3.57 | 1.57 | SP3 | | PFAGRPMIECNECHTWIHLSCAKIRKSNVPEVFVCQKCRDSK |
| 4 | 3mb5A1 | 0.07 | 0.07 | 2.93 | 0.99 | SPARKS-K | | MIREGDKVVLVDPRGKITVSKRDFHTDLGILKLEEIIGRNFG |
| 5 | 5e5wA | 0.30 | 0.29 | 8.67 | 0.21 | FFAS-3D | | -LNPGTYSYCFDTDGGYPIQVVQEWSASRRSDNATEEACLQ- |
| 6 | 1qr0A | 0.20 | 0.19 | 6.12 | 0.26 | HHpred | | ISHSGRWVIGAFDSQPIDIEKTKPISLEIAKRFFSKTEYSD- |
| 7 | 5mqfF1 | 0.25 | 0.21 | 6.64 | 1.03 | MUSTER | | VLSEGSYLLSNAMDNTVRV-----WDVRPFAPKERCVKIFQ- |
| 8 | 2hmjA | 0.20 | 0.10 | 3.05 | 0.63 | CNFpred | | IPAPGDYVTAKMGIDEVIVS---------------------- |
| 9 | 2kq9A | 0.15 | 0.12 | 4.00 | 0.36 | HHsearch-2 | | RIASGTFGTCVKCGKRISEDRLKAVCQECAAAL--------- |
| 10 | 1trjA1 | 0.26 | 0.21 | 6.62 | 0.99 | Neff-PPAS | | --ADGAYALSASWDKTL-----RLWDVATGETYQRFVGHKSD |
| (a) | ID1 is the number of template residues identical to query divided by number of aligned residues. |
| (b) | ID2 is the number of template residues identical to query divided by query sequence length. |
| (c) | Cov is equal the number of aligned template residues divided by query sequence length. |
| (d) | Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold. |
| (e) | Threading program lists the threading program used to identify the template. |
| (f) | Template residues identical to query sequence are highlighted in color. |
|