| Rank | PDB hit | ID1 | ID2 | Cov | Norm. Zscore | Threadingprogram | | 20 40
| | |
| Seq | SILTEIPEQLHESLKRYLETHPDWDQDRVFTAALSLFLLQNGNSDRSAARVYLETLF |
| 1 | 2p6jA | 0.24 | 0.21 | 6.54 | 1.03 | MUSTER | | --MKQWSENVEEKLKEFVKRHQRITQEELHQYAQRLGL------NEEAIRQFFEEFE |
| 2 | 2kelA | 0.14 | 0.11 | 3.58 | 1.02 | SP3 | | VFGIYMDKDLKTRLKVYCAKN-NLQLTQAIEEAIKEYLQKRNG-------------- |
| 3 | 2p6jA | 0.24 | 0.21 | 6.54 | 0.94 | SPARKS-K | | --MKQWSENVEEKLKEFVKRHQRITQEELHQYAQRLGL------NEEAIRQFFEEFE |
| 4 | 5fd4A2 | 0.12 | 0.11 | 3.70 | 0.55 | FFAS-3D | | -------PKIFDSVDKIIQSTQDFQKKPIVSVLKWKYALFVDKDRDEAEKHYLDAV- |
| 5 | 2hzvA | 0.13 | 0.11 | 3.67 | 0.33 | HHpred | | RVTITLDDDLLETLDSLSQRRGYNNRSEAIRDILRSALAQEATQQHG---------- |
| 6 | 2gpeD | 0.21 | 0.16 | 5.02 | 1.00 | MUSTER | | GVK--LDDATRERIKSAATRI-DRTPHWLIKQAIFSYLEQLENSDT----------- |
| 7 | 4hlqA | 0.21 | 0.19 | 6.12 | 0.47 | CNFpred | | --REGLQEELIDIILLILERNPQLHYYQGYHDIVVTFLLVV---GERLATSLVEKLS |
| 8 | 2kelA | 0.14 | 0.11 | 3.58 | 0.28 | HHsearch-2 | | VFGIYMDKDLKTRLKVYCAKNN-LQLTQAIEEAIKEYLQKRNG-------------- |
| 9 | 2p6jA | 0.26 | 0.21 | 6.51 | 0.75 | Neff-PPAS | | ----QWSENVEEKLKEFVKRHQRITQEELHQYAQRLGL------NEEAIRQFFEEFE |
| 10 | 2kelA | 0.14 | 0.11 | 3.58 | 0.38 | HHsearch | | VFGIYMDKDLKTRLKVYCAKNN-LQLTQAIEEAIKEYLQKRNG-------------- |
| (a) | ID1 is the number of template residues identical to query divided by number of aligned residues. |
| (b) | ID2 is the number of template residues identical to query divided by query sequence length. |
| (c) | Cov is equal the number of aligned template residues divided by query sequence length. |
| (d) | Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold. |
| (e) | Threading program lists the threading program used to identify the template. |
| (f) | Template residues identical to query sequence are highlighted in color. |
|