| Rank | PDB hit | ID1 | ID2 | Cov | Norm. Zscore | Threadingprogram | | 20 40
| | |
| Seq | MKKKPVAQAEHQHYLLENPLVYGLLSRLRIAIVVNCFTLANKN |
| 1 | 5lj3S2 | 0.10 | 0.09 | 3.42 | 1.06 | SPARKS-K | | --KEAKIVLLQKYITFEARKLYRRYLELNPQSWIEFAMYQT-- |
| 2 | 1z5sD | 0.18 | 0.09 | 3.02 | 0.21 | FFAS-3D | | YELTPTAEQKALATKLKLPPTF--------------------- |
| 3 | 3j7jF | 0.22 | 0.21 | 6.60 | 0.22 | HHpred | | --HPVILASIVDSYERRNARVIGTLLGTHSVEVTNCFSVPHNE |
| 4 | 6d6yA1 | 0.24 | 0.23 | 7.23 | 0.75 | MUSTER | | FN-QPVNEPFFQVLLKQTPTAH-LLLEYQGELVAAIFTETKNS |
| 5 | 3hfrA | 0.18 | 0.14 | 4.53 | 0.53 | CNFpred | | --------EEVAKFTW--EMTNFLVDRGIKMLVIACNTATAAA |
| 6 | 2pffB | 0.14 | 0.14 | 4.77 | 0.36 | HHsearch-2 | | LSISNLTQEQVQDYVNKTNSHLPAGKQVEISLVNGAKNLVVSH |
| 7 | 5lj3S2 | 0.10 | 0.09 | 3.42 | 0.99 | Neff-PPAS | | --KEAKIVLLQKYITFEARKLYRRYLELNPQSWIEFAMYQT-- |
| 8 | 3ikoF3 | 0.12 | 0.12 | 4.12 | 0.50 | HHsearch | | IKKHSLWRRTVYSLSPYERAIYSYLSGAIPNQELQYSDWESD- |
| 9 | 4fq5B | 0.19 | 0.19 | 6.02 | 0.60 | SP3 | | MRMKHVTKEELARMDGDSDRCALELSDARVVMGYACLVAIMSM |
| 10 | 2aghC | 0.10 | 0.07 | 2.60 | 0.31 | PROSPECTOR2 | | SDDGNILPSDIMDFVLKNTPSMQALGE------------SPES |
| (a) | ID1 is the number of template residues identical to query divided by number of aligned residues. |
| (b) | ID2 is the number of template residues identical to query divided by query sequence length. |
| (c) | Cov is equal the number of aligned template residues divided by query sequence length. |
| (d) | Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold. |
| (e) | Threading program lists the threading program used to identify the template. |
| (f) | Template residues identical to query sequence are highlighted in color. |
|