| Rank | PDB hit | ID1 | ID2 | Cov | Norm. Zscore | Threadingprogram | | 20 40
| | |
| Seq | IWHQPVVAFVGWTLFYFVILMALVYLYGYSGLNSSTFIYNEF |
| 1 | 3dl8C | 0.11 | 0.10 | 3.40 | 1.48 | SPARKS-K | | ---KATISVIIFSLAIGVYLWILDLTFTKIISFILSLR---- |
| 2 | 2l6wA | 0.14 | 0.12 | 4.07 | 1.70 | MUSTER | | LPFKVVVISAILALVVLTIISLIILIMLWQKKPR----YE-- |
| 3 | 5lj3S2 | 0.08 | 0.07 | 2.86 | 1.01 | Neff-PPAS | | --KEAKIVLLQKYITFEARKLYRRYLELNPQSWIEFAMYQT- |
| 4 | 5a1uE4 | 0.19 | 0.19 | 6.14 | 1.19 | SPARKS-K | | ENSESKETGLSHLCEFTVLATRILHLLGQEGPKTNNFIYNRV |
| 5 | 4xgcD2 | 0.17 | 0.17 | 5.45 | 0.29 | FFAS-3D | | --DDKIELLCGLSVLELCLIIAIKHHSQIYDRDSFNFIYARF |
| 6 | 6bwdA | 0.26 | 0.24 | 7.36 | 0.34 | HHpred | | FYHAPIVKFWFNTLAYLGFLMLYTFVVLV-KMEQLPS-VQE- |
| 7 | 2metA | 0.06 | 0.05 | 2.10 | 1.54 | MUSTER | | NLEIIILEGTAVIAMFFWLLLVIILRTVKRANGG-------- |
| 8 | 5ldwM | 0.08 | 0.05 | 1.88 | 0.56 | CNFpred | | -----TALMIAHGLTSSMLFCLANSNYERI------------ |
| 9 | 5wp6A | 0.20 | 0.19 | 6.12 | 0.57 | HHsearch-2 | | FWGAPVTIFMGNVVSYLLFLLLFSRVLL-VDFQPAPPGSLEL |
| 10 | 5t4oK1 | 0.17 | 0.17 | 5.50 | 0.90 | Neff-PPAS | | LPRVVPSADVNVTLSMALGVFILILFYSIKMKGIGGFTKELT |
| (a) | ID1 is the number of template residues identical to query divided by number of aligned residues. |
| (b) | ID2 is the number of template residues identical to query divided by query sequence length. |
| (c) | Cov is equal the number of aligned template residues divided by query sequence length. |
| (d) | Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold. |
| (e) | Threading program lists the threading program used to identify the template. |
| (f) | Template residues identical to query sequence are highlighted in color. |
|