| Rank | PDB hit | ID1 | ID2 | Cov | Norm. Zscore | Threadingprogram | | 20 40
| | |
| Seq | VSATSHTLAIEKVTNECKRRFGKSLLLQTEITEEYSAYQK |
| 1 | 5lj3S2 | 0.21 | 0.20 | 6.38 | 1.03 | MUSTER | | -KEAKIVLLQKYITFEARKLYRRYLELNPQSWIEFAMYQT |
| 2 | 5lj3S2 | 0.21 | 0.20 | 6.38 | 1.08 | Neff-PPAS | | -KEAKIVLLQKYITFEARKLYRRYLELNPQSWIEFAMYQT |
| 3 | 5lj3S2 | 0.21 | 0.20 | 6.38 | 0.94 | SPARKS-K | | -KEAKIVLLQKYITFEARKLYRRYLELNPQSWIEFAMYQT |
| 4 | 3cddD2 | 0.30 | 0.17 | 5.30 | 0.32 | FFAS-3D | | -EVTTAEGAAKRGQWERQRSIGKS---------------- |
| 5 | 1kyqB | 0.21 | 0.17 | 5.55 | 0.35 | HHpred | | ITCIPDHPESARIYHLCKERFGKQQLVNVDKPD------- |
| 6 | 5al6A | 0.16 | 0.15 | 5.00 | 0.93 | MUSTER | | LAALVSLVESVRHEQQQLRNLCEMILEQKEFGENLYFQ-- |
| 7 | 5txmA | 0.25 | 0.23 | 6.97 | 0.45 | CNFpred | | ----QLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWW |
| 8 | 2vg4A1 | 0.26 | 0.15 | 4.62 | 0.42 | HHsearch-2 | | YDRRDLWAACEEY-ASRTRRFGSA---------------- |
| 9 | 6exnD2 | 0.05 | 0.05 | 2.30 | 0.95 | Neff-PPAS | | --RKKNLEMSQRAEMINRSKHAQQEKAVTTDDLDNLVDQV |
| 10 | 1mu2A3 | 0.10 | 0.10 | 3.67 | 0.55 | HHsearch | | KVTHTLAQVVQKIGKEALVIWGRIPKFHLPVEREIWEQW- |
| (a) | ID1 is the number of template residues identical to query divided by number of aligned residues. |
| (b) | ID2 is the number of template residues identical to query divided by query sequence length. |
| (c) | Cov is equal the number of aligned template residues divided by query sequence length. |
| (d) | Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold. |
| (e) | Threading program lists the threading program used to identify the template. |
| (f) | Template residues identical to query sequence are highlighted in color. |
|