| Rank | PDB hit | ID1 | ID2 | Cov | Norm. Zscore | Threadingprogram | | 20 40
| | |
| Seq | DFTWKVFSQTGNIDTYLLFKELEKDTQEMPGNQEEELAEIDFPI |
| 1 | 4wt3A2 | 0.14 | 0.14 | 4.66 | 1.01 | SPARKS-K | | DVGWLDFDYPGDCLSFLYYRQSREN-KNPSDQRTSMLLQALGVA |
| 2 | 3g9rA | 0.20 | 0.18 | 5.84 | 1.34 | MUSTER | | LDKWASLWNWFNITNWLWYIKIEELKSKI-KRIENEIKRIKK-- |
| 3 | 5vidF | 0.24 | 0.18 | 5.68 | 1.06 | SP3 | | ELKAKFFLEIGD-------RDAARNALRKAGYSDEEAERI---I |
| 4 | 2hr2A1 | 0.05 | 0.05 | 2.09 | 0.88 | SPARKS-K | | ------KPLKEVVGAYLALSDAQRQLVAGEYDEAAANCRRAEIS |
| 5 | 2grmA4 | 0.24 | 0.18 | 5.68 | 0.35 | FFAS-3D | | ----NIFKIIGKEDIHRLVEELTKISAKEKFTPPKEVT------ |
| 6 | 5nlaA | 0.16 | 0.14 | 4.55 | 0.25 | HHpred | | -RLYQLFEPSGGVLNYIRRRRLLQAYAEGATI-GDWLKSV---- |
| 7 | 3c64A1 | 0.21 | 0.20 | 6.50 | 1.30 | MUSTER | | DWTHDDFLQT-LLMKDLLLEIIQDTYGDANERIEALLEQAGVGG |
| 8 | 5xqoA | 0.35 | 0.20 | 6.11 | 0.53 | CNFpred | | LFFWLYFLRTGSKDAYRFAEALTRHT------------------ |
| 9 | 5xq3A | 0.23 | 0.23 | 7.14 | 0.35 | HHsearch-2 | | LFFWLYFLRTGSKDAYRFAEALTRHTGEVDVYHIGDWKGLGTRH |
| 10 | 6exnD2 | 0.05 | 0.05 | 2.16 | 0.93 | Neff-PPAS | | NLRKKNLEMSQRAEMINRSKHAQQEKAVTTDDLDNLVDQVF--- |
| (a) | ID1 is the number of template residues identical to query divided by number of aligned residues. |
| (b) | ID2 is the number of template residues identical to query divided by query sequence length. |
| (c) | Cov is equal the number of aligned template residues divided by query sequence length. |
| (d) | Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold. |
| (e) | Threading program lists the threading program used to identify the template. |
| (f) | Template residues identical to query sequence are highlighted in color. |
|