| Rank | PDB hit | ID1 | ID2 | Cov | Norm. Zscore | Threadingprogram | | 20 40
| | |
| Seq | MGKDRQEKRLKASKRVESDRDQSIHYKGATALEGPDSARKRN |
| 1 | 5mlc7 | 0.21 | 0.19 | 6.07 | 1.20 | SPARKS-K | | LEQKIKMKMAKKIRRTGLCAKESLRKRGAW---PPSKMKKLK |
| 2 | 6af0C | 0.12 | 0.12 | 4.19 | 1.21 | MUSTER | | -TLDPRLAQIYSGERRMGDRNTALRGIKPTDFSHVRKLAAPF |
| 3 | 4gdoA | 0.10 | 0.10 | 3.55 | 1.68 | Neff-PPAS | | HMRAEERERLAEVEAALEKQRQLAEAHAQAKAQAEREAKEL- |
| 4 | 5mmm6 | 0.23 | 0.21 | 6.71 | 1.07 | SPARKS-K | | QLKLEQKMKMKMAKKIRLRRNRLLRKRGAW---PPSKMKKLK |
| 5 | 6af0C | 0.13 | 0.12 | 4.12 | 0.35 | FFAS-3D | | ---DPRLAQIYSGERRMGDRNTALRGIKPTDFSHVRKLAAP- |
| 6 | 3w5mA | 0.23 | 0.17 | 5.21 | 0.31 | HHpred | | ------HPDVWDSGKVVSDDSVLVPYAGP-PLKPRTR----- |
| 7 | 5uyoA | 0.24 | 0.21 | 6.67 | 1.16 | MUSTER | | MDVEEQIRRLEEVLK----KNQPVTWNGTT-YTDPNEIKKVI |
| 8 | 2es4D | 0.19 | 0.19 | 6.14 | 0.72 | CNFpred | | QAYAAERDRIAAQGLAPQDRDARIAQLRQQTFTAPGEAIRAA |
| 9 | 3iygQ | 0.38 | 0.14 | 4.24 | 0.42 | HHsearch-2 | | --------------------------EGAKHFSGLEEAVYRN |
| 10 | 3zf7T3 | 0.10 | 0.10 | 3.55 | 1.43 | Neff-PPAS | | AAKRLKDEQNRRKARKQELKKREKERERARRDDAAAAAAAK- |
| (a) | ID1 is the number of template residues identical to query divided by number of aligned residues. |
| (b) | ID2 is the number of template residues identical to query divided by query sequence length. |
| (c) | Cov is equal the number of aligned template residues divided by query sequence length. |
| (d) | Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold. |
| (e) | Threading program lists the threading program used to identify the template. |
| (f) | Template residues identical to query sequence are highlighted in color. |
|