| Rank | PDB hit | ID1 | ID2 | Cov | Norm. Zscore | Threadingprogram | | 20 40
| | |
| Seq | PMNQAGSAQSSPLEALETYLKDIPLNRSIRPQPLSNPWCLSP |
| 1 | 2k8fB | 0.19 | 0.17 | 5.36 | 1.08 | MUSTER | | PQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQA------ |
| 2 | 2fj4A | 0.14 | 0.12 | 4.07 | 1.01 | Neff-PPAS | | ------SCCSCCPAECEKCAKDCVCKGGEAAEAEAEKCSCCQ |
| 3 | 1r1bA | 0.13 | 0.12 | 4.14 | 0.84 | SPARKS-K | | KAEKAPKAKTEAVECLLSLKAEYKEKTGKEYVPGLEHHH--- |
| 4 | 3fayA2 | 0.06 | 0.05 | 2.02 | 0.33 | FFAS-3D | | ------NIKTDPVDIYKSWVNQESQTGEASKLPYDVT----- |
| 5 | 4q84A2 | 0.16 | 0.12 | 3.95 | 0.23 | HHpred | | -CFASFGAHPDFGVALERTVTELLQGRGLKDL---------- |
| 6 | 2fj4A | 0.14 | 0.12 | 4.10 | 1.07 | MUSTER | | ----KSCCSCCPAE-CEKCAKDCVCKGGEAAEAEAEKCSCCQ |
| 7 | 4r3uA | 0.40 | 0.14 | 4.21 | 0.39 | CNFpred | | -----------TLADMEALLADIDLE---------------- |
| 8 | 3bicA3 | 0.17 | 0.14 | 4.71 | 0.32 | HHsearch-2 | | PRVGMAGVAIDTVEDTKILFDGIPLEKM------SVSMTMNG |
| 9 | 1pzqA | 0.14 | 0.14 | 4.86 | 1.01 | Neff-PPAS | | SAASPAVDIGDRLDELEKALEALSAEDGHDLESLLRRWNSRR |
| 10 | 6hbaA | 0.10 | 0.10 | 3.52 | 0.42 | HHsearch | | API-QSTNERQVLSELENCLSEHEGEYVRLTRSRVFEALQR- |
| (a) | ID1 is the number of template residues identical to query divided by number of aligned residues. |
| (b) | ID2 is the number of template residues identical to query divided by query sequence length. |
| (c) | Cov is equal the number of aligned template residues divided by query sequence length. |
| (d) | Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold. |
| (e) | Threading program lists the threading program used to identify the template. |
| (f) | Template residues identical to query sequence are highlighted in color. |
|