| Rank | PDB hit | ID1 | ID2 | Cov | Norm. Zscore | Threadingprogram | | 20 40
| | |
| Seq | VSNNMQPLEARSADLVQEPRYIINVPPRCPPGSKFIKNRCRVIVP |
| 1 | 2ic4A1 | 0.05 | 0.04 | 2.16 | 1.20 | SPARKS-K | | IKHGLYHENMRRPYFPVAVGK--YYSYYCDEHFETPSGSYWDHIH |
| 2 | 1z6cA1 | 0.21 | 0.18 | 5.67 | 1.33 | MUSTER | | ----KDVDECSLKPSICGTAVCKNIPGECPEGYRYNSKSCEDI-- |
| 3 | 3i2tA4 | 0.10 | 0.09 | 3.33 | 1.18 | Neff-PPAS | | -PTTYVLETNPEGKYAYGATCVKECPGSCPQDKMDKGGECVPC-- |
| 4 | 3gawA5 | 0.07 | 0.07 | 2.76 | 1.20 | SPARKS-K | | DNPYIPNGDYSPLRIKHRTGD--EITYQCRNGFYPATRKCTSTGW |
| 5 | 1iycA | 0.17 | 0.11 | 3.64 | 0.22 | FFAS-3D | | -------------PKLPDDKVLIRSRSNCPKGKVWNGFDCKS--- |
| 6 | 1iycA | 0.15 | 0.11 | 3.73 | 0.21 | HHpred | | ------------LPKLPDDKVLIRSRSNCPKGKVWNGFDCKSPFA |
| 7 | 1emnA1 | 0.17 | 0.16 | 5.11 | 1.28 | MUSTER | | V--DMDECKEPDVCKHGQCINTDGSYRECPFGYILAGNECVDT-- |
| 8 | 1xphA | 0.21 | 0.09 | 2.82 | 0.59 | CNFpred | | --------------------------RHCPKDWTFFQGNCYFMSN |
| 9 | 1uv0A | 0.33 | 0.16 | 4.67 | 0.39 | HHsearch-2 | | ------------------------ARIRCPKGSKAYGSHCYALFL |
| 10 | 1emnA1 | 0.17 | 0.13 | 4.40 | 1.10 | Neff-PPAS | | -KEPDVCKHGQCINTDGSYR------CECPFGYILAGNECVDT-- |
| (a) | ID1 is the number of template residues identical to query divided by number of aligned residues. |
| (b) | ID2 is the number of template residues identical to query divided by query sequence length. |
| (c) | Cov is equal the number of aligned template residues divided by query sequence length. |
| (d) | Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold. |
| (e) | Threading program lists the threading program used to identify the template. |
| (f) | Template residues identical to query sequence are highlighted in color. |
|