| Rank | PDB hit | ID1 | ID2 | Cov | Norm. Zscore | Threadingprogram | | 20 40
| | |
| Seq | NTRRCWLCGESLLGHIPFHYLDFSFCSTKCLQAHRQGKAAP |
| 1 | 2n94A | 0.17 | 0.17 | 5.59 | 2.19 | SPARKS-K | | MAVLCGVCGIK-EFKYKCPRCLVQTCSLECSKKHKTRDNCS |
| 2 | 2n94A | 0.17 | 0.17 | 5.59 | 2.43 | MUSTER | | MAVLCGVCGIK-EFKYKCPRCLVQTCSLECSKKHKTRDNCS |
| 3 | 2n94A | 0.17 | 0.17 | 5.59 | 2.25 | Neff-PPAS | | MAVLCGVCGIK-EFKYKCPRCLVQTCSLECSKKHKTRDNCS |
| 4 | 5aieA | 0.20 | 0.20 | 6.24 | 1.68 | SPARKS-K | | MEDYCPLCIEPMDITDKPCPCGYQIC-QFCYNNIRQNPELN |
| 5 | 2w0tA | 0.21 | 0.20 | 6.22 | 0.47 | FFAS-3D | | EPAVCEMCGI-VGTREAFFSKTKRFCSVSCSRSYSSNSKK- |
| 6 | 2n94A | 0.18 | 0.17 | 5.56 | 0.35 | HHpred | | MAVLCGVCGIK-EFKYKCPRCLVQTCSLECSKKHKTRDNC- |
| 7 | 2n95A | 0.17 | 0.17 | 5.59 | 2.16 | MUSTER | | SAVKCGICRGV-DGKYKCPKCGVRYCSLKCYKDAAKHVHKE |
| 8 | 2yqpA | 0.22 | 0.20 | 6.17 | 0.69 | CNFpred | | --PICVVCGRYGEYIC--DKTDEDVCSLECKAKHLLQVKEK |
| 9 | 2dasA | 0.27 | 0.27 | 8.24 | 0.51 | HHsearch-2 | | AKITCANCKKPLQGQTAYQRSAHLFCSTTCLSSFSSGPSSG |
| 10 | 2n95A | 0.17 | 0.17 | 5.59 | 2.03 | Neff-PPAS | | SAVKCGICRGV-DGKYKCPKCGVRYCSLKCYKDAAKHVHKE |
| (a) | ID1 is the number of template residues identical to query divided by number of aligned residues. |
| (b) | ID2 is the number of template residues identical to query divided by query sequence length. |
| (c) | Cov is equal the number of aligned template residues divided by query sequence length. |
| (d) | Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold. |
| (e) | Threading program lists the threading program used to identify the template. |
| (f) | Template residues identical to query sequence are highlighted in color. |
|