Home Research COVID-19 Services Publications People Teaching Job Opening News Forum
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

[an error occurred while processing this directive]


DAMpred for Recognizing Disease-Associated SNP Mutations


DAMpred is a method for predicting Disease-associated mutations of proteins in the human genome. A novel training method integrates Bayes classification and artificial neutral network to comprehensively consider sequence-based, biological assembly-based and I-TASSER model-based features and their corresponding probability density on disease-associated dataset and neutral dataset, respectively.

Figure 1 shows the Flowchart of DAMpred for disease-associated mutation prediction. All the features of DAMpred are derived from protein sequence, so its ability to deliver good predictions without experimental structure high-quality extend the application of disease-associated mutation prediction.



Figure 1: The flowchart of DAMpred method.

The DAMpred algorithm was tested on a set of 10,634 mutations from 2,154 proteins. After excluding homologous templates with sequence identity >30% to the target, I-TASSER was able to build correct structure model with a TM-score > 0.5 for 1,863 proteins. Using the I-TASSER model, DAMpred classifies all mutation into two groups, neutral and disease-associated, with an ACC 0.800 and MCC 0.601 in the protein-level 10-fold cross-validation. DAMpred improve 17% on average MCC, indicating that DAMpred give more balanced accuracy, especially for neutral mutations, compared with others methods.


How to use Molde: Single-point mutations

  • First step: Please copy and paste your data (Note: DAMpred with sequence in FASTA format will run I-TASSER to get 3D structure, which will take more time).
      Either sequence in FASTA format is acceptable:
      KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKM
      VENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHL
      RKSEAQAKKEKLNIWS
  • Second step: Please input a list of mutations (one per mutation set per line with single-point mutations set out off by semicolons, WT residue followed by the position of the mutation followed by the mutated residue). Example,
      L20A; -Single mutation Lys, the 1th residue, is mutated to Ala
      K105M;
  • Last step: You will get the results as shown (>> Example of Output ...).


    References:
    • Lijun Quan, Hongjie Qu, Qiang Lyu, Yang Zhang. DAMpred: Recognizing disease-associated nsSNP mutations through Bayes-guided neural-network model built on low-resolution structure prediction of proteins and protein-protein interactions, submitted (2018).


    Back to DAMpred

  • [an error occurred while processing this directive]

    yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218