[Home] [Back to DMFold server] [Back to Complex result page] [Help]

DMFold results for example-model1-C

[Click result.zip to download all results on this page]


Input Sequence In FASTA Format

example-model1-C ( 732 residues )
>example-C
MKFDKPAGENPIDQLKVVGRPHDRIDGPLKTTGTARYAYEWHEEAPNAAYGYIVGSAIAKGRLTALDTDAAQKAPGVLAVITASNAGALGKGDKNTARLLGGPTIEHYHQAIALVVAETFEQARAAASLVQAHYRRNKGAYSLADEKQAVNQPPEDTPDKNVGDFDGAFTSAAVKIDATYTTPDQSHMAMEPHASMAVWDGNKLTLWTSNQMIDWCRTDLAKTLKVPVENVRIISPYIGGGFGGKLFLRSDALLAALAARAVKRPVKVMLPRPSIPNNTTHRPATLQHLRIGADQSGKITAISHESWSGNLPGGTPETAVQQSELLYAGANRHTGLRLATLDLPEGNAMRAPGEAPGLMALEIAIDELAEKAGIDPVEFRILNDTQVDPADPTRCFSRRQLIECLRTGADKFGWKQRNATPGQVRDGEWLVGHGVAAGFRNNLLEKSGARVHLEQNGTVTVETDMTDIGTGSYTILAQTAAEMLGVPLEQVAVHLGDSSFPVSAGSGGQWGANTSTSGVYAACMKLREMIASAVGFDPEQSQFADGKITNGTRSATLHEATAGGRLTAEESIEFGTLSKEYQQSTFAGHFVEVGVHSATGEVRVRRMLAVCAAGRILNPKTARSQVIGAMTMGMGAALMEELAVDDRLGYFVNHDMAGYEVPVHADIPKQEVIFLDDTDPISSPMKAKGVGELGLCGVSAAIANAVYNATGIRVRDYPITLDKLLDKLPDVV

  Multiple Sequence Alignments

Alignment depth: Nf=177.016, number of sequences=6505


  • Download multiple sequence alignment in aln format.
  • Download multiple sequence alignment in a3m format.
    		•

     Predicted Contact And Distance Map

    Contact Map
    		 Distance Map

     Top 1 Final Models From DMFold

    Click
    to view    		 RankDownload PDBpLDDT
    1 model1.pdb.gz 0.99

    Note: If the JSmol model is not visible, please refresh the page or click the radio buttons

    (a) DMFold generates a large set of structural models by different MSAs as inputs. These models are ranked by predicted TM-score (pTM-score for multimer) or predicted LDDT (pLDDT for monomer) and top 1 models are selected with the highest predicted scores.

     Residue-level Modeling Quality


    pLDDT of chain C


     Proteins With Similar Structure

    Top 10 structural analogs in PDB (as identified by TM-align)

    Click
    to view    		RankPDB
    Hit    		TM-scoreRMSDaIDENaCov.Download
    Alignment
    15g5gC1.000.171.001.00Download
    25y6qC0.932.190.390.97Download
    31t3qB0.922.490.230.98Download
    41jroB0.922.620.240.97Download
    51sb3D0.912.560.270.96Download
    61ffvB0.903.000.210.97Download
    71n63B0.903.030.210.97Download
    88hxmB0.902.730.220.96Download
    91wygA0.902.710.220.96Download
    107dqxA0.892.960.240.96Download

    Note: If the JSmol model is not visible, please refresh the page or click the radio buttons

    (a)Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
    (b)Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
    (c)RMSDa is the RMSD between residues that are structurally aligned by TM-align.
    (d)IDENa is the percentage sequence identity in the structurally aligned region.
    (e)Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

    Predicted Gene Ontology (GO) Terms


    example-model1-C/GOsearchresult_final_MF.svg
    Molecular Function (MF)
    GO termCscoreGOName
    GO:00164911.00oxidoreductase activity
    GO:19013630.97heterocyclic compound binding
    GO:00971590.97organic cyclic compound binding
    GO:00506620.97coenzyme binding
    GO:00506600.96flavin adenine dinucleotide binding
    GO:00169030.96oxidoreductase activity, acting on the aldehyde or oxo group of donors
    GO:00167260.96oxidoreductase activity, acting on CH or CH2 groups, NAD or NADP as acceptor
    GO:00048540.95xanthine dehydrogenase activity

    Download full result of the above consensus prediction.

    Click the graph to show a high resolution version.
    (a)CscoreGO is the confidence score of predicted GO terms. CscoreGO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.
    (b)The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by CscoreGO:
    [0.4,0.5)[0.5,0.6)[0.6,0.7)[0.7,0.8)[0.8,0.9)[0.9,1.0]

    example-model1-C/GOsearchresult_final_BP.svg
    Biological Process (BP)
    GO termCscoreGOName
    GO:00447101.00single-organism metabolic process
    GO:00442371.00cellular metabolic process
    GO:19015640.99organonitrogen compound metabolic process
    GO:00447630.99single-organism cellular process
    GO:00442810.99small molecule metabolic process
    GO:00061390.99nucleobase-containing compound metabolic process
    GO:19015650.98organonitrogen compound catabolic process
    GO:19013610.98organic cyclic compound catabolic process
    GO:00725210.98purine-containing compound metabolic process
    GO:00447120.98single-organism catabolic process
    GO:00194390.98aromatic compound catabolic process
    GO:00091120.98nucleobase metabolic process
    GO:00091150.97xanthine catabolic process

    Download full result of the above consensus prediction.

    Click the graph to show a high resolution version.
    (a)CscoreGO is the confidence score of predicted GO terms. CscoreGO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.
    (b)The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by CscoreGO:
    [0.4,0.5)[0.5,0.6)[0.6,0.7)[0.7,0.8)[0.8,0.9)[0.9,1.0]

    example-model1-C/GOsearchresult_final_CC.svg
    Cellular Component (CC)
    GO termCscoreGOName
    GO:00444241.00intracellular part
    GO:00058290.99cytosol

    Download full result of the above consensus prediction.

    Click the graph to show a high resolution version.
    (a)CscoreGO is the confidence score of predicted GO terms. CscoreGO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.
    (b)The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by CscoreGO:
    [0.4,0.5)[0.5,0.6)[0.6,0.7)[0.7,0.8)[0.8,0.9)[0.9,1.0]


     Predicted Enzyme Commission (EC) Numbers

    Top 5 enzyme homologs in PDB

    Click
    to view    		RankCscoreECPDB
    Hit    		TM-scoreRMSDaIDENaCov.EC NumberPredicted Active Site Residues
    10.1931ffuB0.9023.000.2120.9741.2.99.2 NA
    20.1641vlbA0.8862.740.2330.9441.2.99.7 NA
    30.1042e1qA0.8992.710.2230.9591.17.3.2 1.17.1.4 NA
    40.1022ckjA0.8942.790.2290.9581.17.1.4 1.17.3.2 NA
    50.0601t3qB0.9252.490.2250.9771.3.99.17 NA

    Note: If the JSmol model is not visible, please refresh the page or click the radio buttons

     Click on the radio buttons to visualize predicted active site residues.
    (a)CscoreEC is the confidence score for the Enzyme Commission (EC) number prediction. CscoreEC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction.
    (b)TM-score is a measure of global structural similarity between query and template protein.
    (c)RMSDa is the RMSD between residues that are structurally aligned by TM-align.
    (d)IDENa is the percentage sequence identity in the structurally aligned region.
    (e)Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

     Predicted Ligand Binding Sites

    Template proteins with similar binding site:

    Click
    to view    		RankCscoreLBPDB
    Hit    		TM-scoreRMSDaIDENaCov.BS-scoreLig. NameDownload
    Complex    		Predicted binding site residues
    1 0.14 2w54B 0.916 2.62 0.243 0.973 0.79 UUU Download 2211,240,241,242,243,468,469,470,511,512,626,691,692
    2 0.12 3eubU 0.895 2.56 0.221 0.951 0.54 UUU Download 2240,241,242,243,246,512,625,691,692
    3 0.07 1n620 0.901 2.99 0.211 0.974 0.64 III Download 228,32,34,203,217,228,229,458,459,462,489,490,491,492,499,502
    4 0.06 1ffv0 0.901 3.00 0.211 0.974 0.53 III Download 228,32,34,217,490,492,499
    5 0.05 2ckjA 0.894 2.79 0.229 0.958 0.59 FES Download 227,33,34,35,36
    6 0.05 1ffv2 0.901 3.00 0.211 0.974 0.58 III Download 1188,190,191,238,239,240,242,271,272,469,620,624,625,627,628,631,632,656,657,662,663,664,665,667,669,670

    Note: If the JSmol model is not visible, please refresh the page or click the radio buttons

      Click on the radio buttons to visualize predicted binding site and residues.
    (a)CscoreLB is the confidence score of predicted binding site. CscoreLB values range in between [0-1]; where a higher score indicates a more reliable ligand-binding site prediction.
    (b)BS-score is a measure of local similarity (sequence & structure) between template binding site and predicted binding site in the query structure. Based on large scale benchmarking analysis, we have observed that a BS-score >1 reflects a significant local match between the predicted and template binding site.
    (c)TM-score is a measure of global structural similarity between query and template protein.
    (d)RMSDa the RMSD between residues that are structurally aligned by TM-align.
    (e)IDENa is the percentage sequence identity in the structurally aligned region.
    (f)Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

    [Back to server]
    Reference:
  • Wei Zheng, Qiqige Wuyun, Yang Li, Chengxin Zhang, P Lydia Freddolino, Yang Zhang. Improving deep learning protein monomer and complex structure prediction using DeepMSA2 with huge metagenomics data. Nature Methods, (2024). https://doi.org/10.1038/s41592-023-02130-4.
  • Wei Zheng, Quancheng Liu, Qiqige Wuyun, P. Lydia Freddolino, Yang Zhang. DMFold: A deep learning platform for protein complex structure and function predictions based on DeepMSA2. In preparation.
  • Wei Zheng, Qiqige Wuyun, Peter L Freddolino, Yang Zhang. Integrating deep learning, threading alignments, and a multi-MSA strategy for high-quality protein monomer and complex structure prediction in CASP15. 1-20. Proteins. (2023). doi:10.1002/prot.26585.

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218