Zhang Lab

University of Michigan

Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only

Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

GLASS

You can:

Go to the GPCR, ligand, or experimental data tables.
Go to the experimental data table for text mining information in PubMed ID column.
Go to the GPCR page and check other ligands which interact with it.
Go to the ligand page and check other GPCRs which it interacts with.
Go back to previous page.

GPCR

Name	D(2) dopamine receptor
Species	Homo sapiens (Human)
Gene	DRD2
Synonym	dopamine receptor 2 Dopamine D2 receptor D2R D2A and D_2B D2(415) and D₂₍₄₄₄₎ D2 receptor [ Show all ]
Disease	Substance dependence Major depressive disorder Maintain blood pressure in hypotensive states Insomnia Inflammatory disease Inflammatory bowel disease Idiopathic thrombocytopenic purpura Hypertension; Angina pectoris Hypertension Hyperprolactinemia Huntington's disease Glaucoma Gastrointestinal problems Malignant phaeochromocytoma; Benign prostatic hypertrophy; Malignant essential hypertension Migraine headaches Nasal congestion Sexual dysfunction Schizophrenia; Schizoaffective disorders Schizophrenia; Bipolar disorder Schizophrenia Psychotic disorders Psychosis Postpartum haemorrhage Peripheral vasoconstriction; Pulmonary hypertension Parkinson's disease Pain; Inflammatory diseases Ophthalmic disease Non-small cell lung cancer Nausea; Vomiting Fibrosis False perceptions; Bipolar disorder Emesis Chronic obstructive pulmonary disease Cerebrovascular ischaemia Cardiotonic Cardiac failure Bacterial infections Breast cancer Bipolar disorder; Schizophrenia Bipolar disorder Corneal vascularity; Hyperaemia; Itching Asthma; Bronchitis Anxiety disorder Carcinoid syndrome; Acromegaly Advanced stage Parkinson's disease Dermal necrosis Depressive fatigue Alcohol use disorders Allergy Alzheimer disease Hypotension [ Show all ]
Length	443
Amino acid sequence	MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQNECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFLKILHC
UniProt	P14416
Protein Data Bank	6cm4, 6c38
GPCR-HGmod model	P14416
3D structure model	This structure is from PDB ID 6cm4.
BioLiP	BL0408379, BL0403379
Therapeutic Target Database	T67162
ChEMBL	CHEMBL217
IUPHAR	215
DrugBank	BE0000756

Ligand

Name	ADTN
Molecular formula	C10H13NO2
IUPAC name	6-amino-5,6,7,8-tetrahydronaphthalene-2,3-diol
Molecular weight	179.219
Hydrogen bond acceptor	3
Hydrogen bond donor	3
XlogP	1.4
Synonyms	2-Amino-6,7-dihydroxy-1,2,3,4-tetrahydronaphthalene 6,7-Dihydroxy-3-chromanamine AC1L1FAH CCG-204507 FT-0645288 KBio2_007647 NCGC00015291-02 NCGC00162147-04 SR-01000075362-6 2-aminotetralin-6,7-diol;hydrobromide 6-amino-5,6,7,8-tetrahydronaphthalene-2,3-diol AKOS006328808 cid_11957526 HMS1990C05 KBioSS_002519 NCGC00015291-05 PDSP2_000476 (+)-ADTN 2,3-Naphthalenediol, 6-amino-5,6,7,8-tetrahydro- 6,7-Adtn BPBio1_001127 CTK4J8115 KBio2_002511 LS-175452 NCGC00162147-02 SMR001254097 2-Amino-6,7-dihydroxytetralin 6-Amino-5,6,7,8-tetrahydro-2,3-naphthalenediol AC1Q79PY GTPL932 KBio3_002989 NCGC00015291-03 PDSP1_000478 463A788 6-amino-5,6,7,8-tetrahydronaphthalene-2,3-diol;hydrobromide BDBM81195 cid_3153 HMS3403C05 L000081 NCGC00015291-06 PDSP2_000807 (+)-ADTN (aminotetralin-6,7-diol) 2,3-Naphthalenediol,6-amino-5,6,7,8-tetrahydro- 6,7-Dihydroxy-2-aminotetralin BSPBio_001023 D0X2NO KBio2_005079 MLS002172466 NCGC00162147-03 SR-01000075362 2-aminotetralin-6,7-diol 6-Amino-5,6,7,8-tetrahydro-naphthalene-2,3-diol CHEMBL26736 HMS1792C05 KBioGR_002511 NCGC00015291-04 PDSP1_000820 53463-78-8 6-azanyl-5,6,7,8-tetrahydronaphthalene-2,3-diol;hydrobromide Biomol-NT_000003 cMAP_000069 KB-199024 Lopac0_000415 NCGC00162147-01 SCHEMBL3126243 [ Show all ]
Inchi Key	ASXGAOFCKGHGMF-UHFFFAOYSA-N
Inchi ID	InChI=1S/C10H13NO2/c11-8-2-1-6-4-9(12)10(13)5-7(6)3-8/h4-5,8,12-13H,1-3,11H2
PubChem CID	3153
ChEMBL	CHEMBL26736
IUPHAR	932
BindingDB	81195
DrugBank	N/A
Structure SDF download
Lipinski's druglikeness	This ligand satisfies Lipinski's rule of five.

Experimental Data

Parameter	Value	Reference	Database source
IC50	4e-08 nM	PMID3156993	ChEMBL

zhanglabzhanggroup.org | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218