Zhang Lab

University of Michigan

Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only

Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

GLASS

You can:

Go to the GPCR, ligand, or experimental data tables.
Go to the experimental data table for text mining information in PubMed ID column.
Go to the GPCR page and check other ligands which interact with it.
Go to the ligand page and check other GPCRs which it interacts with.
Go back to previous page.

GPCR

Name	D(2) dopamine receptor
Species	Homo sapiens (Human)
Gene	DRD2
Synonym	dopamine receptor 2 Dopamine D2 receptor D2R D2A and D_2B D2(415) and D₂₍₄₄₄₎ D2 receptor [ Show all ]
Disease	Substance dependence Major depressive disorder Maintain blood pressure in hypotensive states Insomnia Inflammatory disease Inflammatory bowel disease Idiopathic thrombocytopenic purpura Hypertension; Angina pectoris Hypertension Hyperprolactinemia Huntington's disease Glaucoma Gastrointestinal problems Malignant phaeochromocytoma; Benign prostatic hypertrophy; Malignant essential hypertension Migraine headaches Nasal congestion Sexual dysfunction Schizophrenia; Schizoaffective disorders Schizophrenia; Bipolar disorder Schizophrenia Psychotic disorders Psychosis Postpartum haemorrhage Peripheral vasoconstriction; Pulmonary hypertension Parkinson's disease Pain; Inflammatory diseases Ophthalmic disease Non-small cell lung cancer Nausea; Vomiting Fibrosis False perceptions; Bipolar disorder Emesis Chronic obstructive pulmonary disease Cerebrovascular ischaemia Cardiotonic Cardiac failure Bacterial infections Breast cancer Bipolar disorder; Schizophrenia Bipolar disorder Corneal vascularity; Hyperaemia; Itching Asthma; Bronchitis Anxiety disorder Carcinoid syndrome; Acromegaly Advanced stage Parkinson's disease Dermal necrosis Depressive fatigue Alcohol use disorders Allergy Alzheimer disease Hypotension [ Show all ]
Length	443
Amino acid sequence	MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQNECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFLKILHC
UniProt	P14416
Protein Data Bank	6cm4, 6c38
GPCR-HGmod model	P14416
3D structure model	This structure is from PDB ID 6cm4.
BioLiP	BL0408379, BL0403379
Therapeutic Target Database	T67162
ChEMBL	CHEMBL217
IUPHAR	215
DrugBank	BE0000756

Ligand

Name	DL-CYSTINE
Molecular formula	C6H12N2O4S2
IUPAC name	2-amino-3-[(2-amino-2-carboxyethyl)disulfanyl]propanoic acid
Molecular weight	240.292
Hydrogen bond acceptor	8
Hydrogen bond donor	4
XlogP	-6.3
Synonyms	cistina Cystine,(S) FT-0625453 (H-DL-Cys-OH)2 MCULE-2293704247 2-amino-3-[(2-amino-2-carboxy-ethyl)disulfanyl]propanoic acid NSC-203781 3055-EP2272972A1 NSC_67678 SR-01000872746-1 ACMC-209ibx Zystin AM81645 Bis(.beta.-amino-.beta.-carboxyethyl)disulfide Cystin Dicysteine K684 .beta.,.beta.'-dicarboxydiethyl disulfide NCGC00164531-01 2-amino-3-[(2-amino-3-hydroxy-3-oxo-propyl)disulfanyl]propanoic acid NSC13203 3055-EP2287152A2 PubChem12373 923C320 STL163324 AKOS000121517 ANW-43036 C6H12N2O4S2 Cystine, DL- DL-Cystine, free base (+)-3,3'-DITHIO-bis-(2-AMINOPROPIONIC) L-3,3'-dithiodialanine .beta.,.beta.'-Dithiodialanine NE11203 3,3'-Dithiobis (2-aminopropanoic acid) NSC755897 4CH-013472 SCHEMBL10224 AC1Q28K0 VA50617 Alanine,3'-dithiodi- BDBM86199 CHEBI:17376 CTK3I6828 Cystine_RamanathanGurudeeban GM5088 MFCD00084652 2-amino-3-[(2-amino-2-carboxy-ethyl)disulfanyl]propionic acid NSC-205366 3055-EP2272973A1 Pharmakon1600-01300099 90350-38-2 ST2417205 ACMC-209luu AN-44446 C-9765 cystine KB-50299 .beta.,.beta.'-dicarboxydiethyldisulfide NCGC00164531-02 2-amino-3-[(2-amino-3-hydroxy-3-oxopropyl)disulfanyl]propanoic acid NSC203781 3055-EP2295410A1 RTC-066536 AB1007082 TC-066536 AKOS016050601 AX8035437 CAS_595 Cystine, L- EN300-34180 (+/-)-3,3'-Dithiobis(2-aminopropionicacid) LEVWYRKDKASIDU-UHFFFAOYSA-N 2-amino-3-(2-amino-3-hydroxy-3-oxopropyl)disulfanylpropansäure NSC-13203 3,3'-Dithiobis(2-aminopropionic acid) NSC_595 5228F255-51E7-421E-8A05-4687B20118CB SR-01000872746 ACMC-1AZ5O Z56346947 alpha-Diamino-beta-dithiolactic acid Bis(.beta.-amino-.beta.-carboxyethyl) disulfide CHEMBL366563 Cystein disulfide D-Cystine I14-5269 .beta.,.beta.'-Diamino-.beta.,.beta.'-dicarboxydiethyl disulfide MolPort-001-779-797 2-amino-3-[(2-amino-2-carboxyethyl)disulfanyl]propanoic acid NSC-755897 3055-EP2277872A1 Propanoic acid,3'-dithiobis[2-amino-, [R-(R,R)]- 923-32-0 ST45022122 AK-80477 AN-47975 C01420 CYSTINE, (L) DL-Cystine, 99% ( inverted exclamation markA)-3,3 inverted exclamation marka-Dithiobis(2-aminopropionicacid) KS-00000YBE .beta.,.beta.'-Dithiobisalanine NCGC00164531-03 3,3'-disulfanediylbis(2-aminopropanoic acid) NSC205366 3055-EP2301939A1 SBI-0207067.P001 AC1L19KY TRA0048972 Alanine,3'-dithiobis- BBL011587 CAS_67678 [ Show all ]
Inchi Key	LEVWYRKDKASIDU-UHFFFAOYSA-N
Inchi ID	InChI=1S/C6H12N2O4S2/c7-3(5(9)10)1-13-14-2-4(8)6(11)12/h3-4H,1-2,7-8H2,(H,9,10)(H,11,12)
PubChem CID	595
ChEMBL	N/A
IUPHAR	N/A
BindingDB	86199
DrugBank	N/A
Structure SDF download
Lipinski's druglikeness	This ligand satisfies Lipinski's rule of five.

Experimental Data

Parameter	Value	Reference	Database source
Ki	<10000.0 nM	PMID12649361	PDSP,BindingDB

zhanglabzhanggroup.org | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218