Zhang Lab

University of Michigan

Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only

Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

GLASS

You can:

Go to the GPCR, ligand, or experimental data tables.
Go to the experimental data table for text mining information in PubMed ID column.
Go to the GPCR page and check other ligands which interact with it.
Go to the ligand page and check other GPCRs which it interacts with.
Go back to previous page.

GPCR

Name	D(2) dopamine receptor
Species	Homo sapiens (Human)
Gene	DRD2
Synonym	dopamine receptor 2 Dopamine D2 receptor D2R D2A and D_2B D2(415) and D₂₍₄₄₄₎ D2 receptor [ Show all ]
Disease	Substance dependence Major depressive disorder Maintain blood pressure in hypotensive states Insomnia Inflammatory disease Inflammatory bowel disease Idiopathic thrombocytopenic purpura Hypertension; Angina pectoris Hypertension Hyperprolactinemia Huntington's disease Glaucoma Gastrointestinal problems Malignant phaeochromocytoma; Benign prostatic hypertrophy; Malignant essential hypertension Migraine headaches Nasal congestion Sexual dysfunction Schizophrenia; Schizoaffective disorders Schizophrenia; Bipolar disorder Schizophrenia Psychotic disorders Psychosis Postpartum haemorrhage Peripheral vasoconstriction; Pulmonary hypertension Parkinson's disease Pain; Inflammatory diseases Ophthalmic disease Non-small cell lung cancer Nausea; Vomiting Fibrosis False perceptions; Bipolar disorder Emesis Chronic obstructive pulmonary disease Cerebrovascular ischaemia Cardiotonic Cardiac failure Bacterial infections Breast cancer Bipolar disorder; Schizophrenia Bipolar disorder Corneal vascularity; Hyperaemia; Itching Asthma; Bronchitis Anxiety disorder Carcinoid syndrome; Acromegaly Advanced stage Parkinson's disease Dermal necrosis Depressive fatigue Alcohol use disorders Allergy Alzheimer disease Hypotension [ Show all ]
Length	443
Amino acid sequence	MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQNECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFLKILHC
UniProt	P14416
Protein Data Bank	6cm4, 6c38
GPCR-HGmod model	P14416
3D structure model	This structure is from PDB ID 6cm4.
BioLiP	BL0408379, BL0403379
Therapeutic Target Database	T67162
ChEMBL	CHEMBL217
IUPHAR	215
DrugBank	BE0000756

Ligand

Name	SB 204741
Molecular formula	C14H14N4OS
IUPAC name	1-(1-methylindol-5-yl)-3-(3-methyl-1,2-thiazol-5-yl)urea
Molecular weight	286.353
Hydrogen bond acceptor	3
Hydrogen bond donor	2
XlogP	2.4
Synonyms	BCP28144 CHEMBL323356 HMS3260D12 MFCD00923644 N-(1-METHYL-1H-INDOLYL-5-YL)-N''-(3-METHYL-5-ISOTHIAZOLYL)UREA NCGC00025129-01 S 0693 SR-01000075765 Tocris-1372 1-(1-methyl-1H-indol-5-yl)-3-(3-methyl-1,2-thiazol-5-yl)urea A809277 C-18040 DTXSID80390956 KB-298203 N-(1-Methyl-1H-5-indolyl)-N inverted exclamation marka-(3-methyl-5-isothiazolyl)urea NCGC00015923-02 NCGC00260940-01 SB-204,741 ZINC16912 1-(1-methylindol-5-yl)-3-(3-methyl-1,2-thiazol-5-yl)urea API0007588 CHEBI:140936 GTPL221 Lopac0_000255 N-(1-Methyl-1H-indol-5-yl)-N'-(3-methyl-5-isothiazolyl)urea NCGC00015923-05 PDSP2_001564 SCHEMBL3377716 SR-01000075765-1 3-(3-METHYL-1,2-THIAZOL-5-YL)-1-(1-METHYLINDOL-5-YL)UREA BDBM84991 CTK8F0087 HMS3369K08 MLS000862184 N-(1-methyl-5-indolyl)-N'-(3-methyl-5-isothiazolyl)urea NCGC00025129-02 Tox21_500255 1-(1-methyl-1H-indol-5-yl)-3-(3-methylisothiazol-5-yl)urea AC1MLYNA CAS_3277600 EU-0100255 L000536 N-(1-Methyl-1H-5-indolyl)-N'-(3-methyl-5-isothiazolyl)urea NCGC00015923-03 NSC_3277600 SB-204741 152239-46-8 B6708 HMS2231C03 LP00255 N-(1-Methyl-1H-indolyl-5-yl)-N''-(3-methyl-5-isothiazolyl) urea NCGC00015923-06 RTX-011453 SMR000326947 SR-01000075765-3 BRD-K15391446-001-11-0 D04AZE J-008905 MolPort-003-959-484 NCGC00015923-01 NCGC00025129-03 SB 204741, >98% (HPLC) ZB000747 1-(1-methyl-5-indolyl)-3-(3-methyl-5-isothiazolyl)urea AKOS024456556 CCG-204350 FT-0643481 Lopac-S-0693 N-(1-Methyl-1H-indo-5-yl)-N'-(3-methyl-5-isothiazolyl)urea NCGC00015923-04 PDSP1_001580 SB204741 [ Show all ]
Inchi Key	USFUFHFQWXDVMH-UHFFFAOYSA-N
Inchi ID	InChI=1S/C14H14N4OS/c1-9-7-13(20-17-9)16-14(19)15-11-3-4-12-10(8-11)5-6-18(12)2/h3-8H,1-2H3,(H2,15,16,19)
PubChem CID	3277600
ChEMBL	CHEMBL323356
IUPHAR	221
BindingDB	84991
DrugBank	N/A
Structure SDF download
Lipinski's druglikeness	This ligand satisfies Lipinski's rule of five.

Experimental Data

Parameter	Value	Reference	Database source
Ki	<10000.0 nM	PMID8788493	PDSP,BindingDB
Ki	>31622.8 nM	PMID7699699	ChEMBL

yangzhanglabzhanggroup.org | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218