Zhang Lab

University of Michigan

Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only

Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

GLASS

You can:

Go to the GPCR, ligand, or experimental data tables.
Go to the experimental data table for text mining information in PubMed ID column.
Go to the GPCR page and check other ligands which interact with it.
Go to the ligand page and check other GPCRs which it interacts with.
Go back to previous page.

GPCR

Name	P2Y purinoceptor 14
Species	Rattus norvegicus (Rat)
Gene	P2ry14
Synonym	UDP-glucose receptor purinergic receptor P2Y P2Y14 receptor P2Y14 P2Y purinoceptor 14 GPR105 G-protein coupled receptor 105 G protein-coupled receptor 105 G protein coupled receptor for UDP-glucose VTR 15-20 [ Show all ]
Disease	N/A for non-human GPCRs
Length	305
Amino acid sequence	MDNTTTTEPPKQPCTRNTLITQQIIPMLYCVVFITGVLLNGISGWIFFYVPSSKSFIIYLKNIVVADFLMGLTFPFKVLSDSGLGPWQLNVFVFRVSAVIFYVNMYVSIAFFGLISFDRYYKIVKPLLVSIVQSVNYSKVLSVLVWVLMLLLAVPNIILTNQSVKDVTNIQCMELKNELGRKWHKASNYVFVSIFWIVFLLLTVFYMAITRKIFKSHLKSRKNSISVKRKSSRNIFSIVLAFVACFAPYHVARIPYTKSQTEGHYSCQAKETLLYTKEFTLLLSAANVCLDPISISSYASRLEKS
UniProt	O35881
Protein Data Bank	N/A
GPCR-HGmod model	N/A
3D structure model	No available structures or models
BioLiP	N/A
Therapeutic Target Database	N/A
ChEMBL	N/A
IUPHAR	330
DrugBank	N/A

Ligand

Name	Udp-glucuronic acid
Molecular formula	C15H22N2O18P2
IUPAC name	(2S,3S,4S,5R,6R)-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-hydroxyphosphoryl]oxy-3,4,5-trihydroxyoxane-2-carboxylic acid
Molecular weight	580.285
Hydrogen bond acceptor	18
Hydrogen bond donor	9
XlogP	-6.4
Synonyms	Uridine pyrophosphoglucuronic acid alpha-delta-Glucopyranuronic acid ester with uridine 5'-pyrophosphate DB03041 UDP-alpha-delta-glucuronate UDPGA Uridine 5'-diphospho-alpha-delta-glucuronate uridine diphosphate glucuronic acid Uridine diphospho-D-glucuronic acid Uridinediphosphoglucuronic acid AC1L2A28 C00167 HDYANYHVCAPMJV-LXQIFKJMSA-N UDP-delta-glucuronate UNII-04SZC4MEFQ Uridine 5'-diphosphoglucuronate Uridine diphosphoglucuronic acid alpha-delta-Glucopyranuronic acid 1->5'-ester with uridine 5'-(trihydrogen pyrophosphate) CHEMBL228057 UDP-alpha-D-glucuronate UDP-glucuronate Uridine 5'-diphospho-a-D-glucuronate uridine 5'-[3-(D-glucopyranosyloxyuronic acid) dihydrogen diphosphate] Uridine diphosphate-glucuronate URIDINE-5'-DIPHOSPHATE-GLUCURONIC ACID a-D-Glucopyranuronic acid 1->5'-ester with uridine 5'-(trihydrogen pyrophosphate) BDBM50209665 Glucopyranuronic acid 1-ester with uridine 5'-pyrophosphate UDP-D-glucuronate UDPglucuronate Uridine 5'-diphospho-alpha-delta-glucuronic acid Uridine diphospho-delta-glucuronate ZINC8215691 (2S,3S,4S,5R,6R)-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-hydroxyphosphoryl]oxy-3,4,5-trihydroxyoxane-2-carboxylic acid alpha-D-Glucopyranuronic acid 1-P'-ester with uridine 5'-(trihydrogen diphosphate) CHEBI:17200 UDP glucuronate UDP-delta-glucuronic acid uridine 5''-[3-(alpha-D-glucopyranuronosyl) dihydrogen diphosphate] Uridine 5'-diphosphoglucuronic acid Uridine pyrophosphoglucuronate 2616-64-0 alpha-delta-Glucopyranuronic acid 1-P'-ester with uridine 5'-(trihydrogen diphosphate) D0O8AN UDP-alpha-D-glucuronic acid Uridine 5'-diphospho-a-D-glucuronic acid uridine diphosphate glucuronate Uridine diphospho-D-glucuronate Uridine-5'-Diphosphoglucuronic Acid a-D-Glucopyranuronic acid ester with uridine 5'-pyrophosphate bmse000292 GTPL1784 UDP-D-glucuronic acid UGA Uridine 5'-diphospho-glucuronic acid Uridine diphospho-delta-glucuronic acid 04SZC4MEFQ alpha-D-Glucopyranuronic acid, 1-P'-ester with uridine 5'-(trihydrogen diphosphate) Udp glucuronic acid udp-glcua Uridine 5'-diphosphate alpha-D-Glucopyranuronic acid uridine 5'-[3-(alpha-D-glucopyranuronosyl) dihydrogen diphosphate] [ Show all ]
Inchi Key	HDYANYHVCAPMJV-LXQIFKJMSA-N
Inchi ID	InChI=1S/C15H22N2O18P2/c18-5-1-2-17(15(26)16-5)12-9(22)6(19)4(32-12)3-31-36(27,28)35-37(29,30)34-14-10(23)7(20)8(21)11(33-14)13(24)25/h1-2,4,6-12,14,19-23H,3H2,(H,24,25)(H,27,28)(H,29,30)(H,16,18,26)/t4-,6-,7+,8+,9-,10-,11+,12-,14-/m1/s1
PubChem CID	17473
ChEMBL	CHEMBL228057
IUPHAR	1784
BindingDB	50209665
DrugBank	N/A
Structure SDF download
Lipinski's druglikeness	This ligand has more than 5 hydrogen bond donor. This ligand has more than 10 hydrogen bond acceptor. This ligand is heavier than 500 daltons.

Experimental Data

Parameter	Value	Reference	Database source
EC50	100.0 nM	PMID11735218	IUPHAR

zhanglabzhanggroup.org | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218