Zhang Lab

University of Michigan

Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only

Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

GLASS

You can:

Go to the GPCR, ligand, or experimental data tables.
Go to the experimental data table for text mining information in PubMed ID column.
Go to the GPCR page and check other ligands which interact with it.
Go to the ligand page and check other GPCRs which it interacts with.
Go back to previous page.

GPCR

Name	D(2) dopamine receptor
Species	Homo sapiens (Human)
Gene	DRD2
Synonym	dopamine receptor 2 Dopamine D2 receptor D2R D2A and D_2B D2(415) and D₂₍₄₄₄₎ D2 receptor [ Show all ]
Disease	Substance dependence Major depressive disorder Maintain blood pressure in hypotensive states Insomnia Inflammatory disease Inflammatory bowel disease Idiopathic thrombocytopenic purpura Hypertension; Angina pectoris Hypertension Hyperprolactinemia Huntington's disease Glaucoma Gastrointestinal problems Malignant phaeochromocytoma; Benign prostatic hypertrophy; Malignant essential hypertension Migraine headaches Nasal congestion Sexual dysfunction Schizophrenia; Schizoaffective disorders Schizophrenia; Bipolar disorder Schizophrenia Psychotic disorders Psychosis Postpartum haemorrhage Peripheral vasoconstriction; Pulmonary hypertension Parkinson's disease Pain; Inflammatory diseases Ophthalmic disease Non-small cell lung cancer Nausea; Vomiting Fibrosis False perceptions; Bipolar disorder Emesis Chronic obstructive pulmonary disease Cerebrovascular ischaemia Cardiotonic Cardiac failure Bacterial infections Breast cancer Bipolar disorder; Schizophrenia Bipolar disorder Corneal vascularity; Hyperaemia; Itching Asthma; Bronchitis Anxiety disorder Carcinoid syndrome; Acromegaly Advanced stage Parkinson's disease Dermal necrosis Depressive fatigue Alcohol use disorders Allergy Alzheimer disease Hypotension [ Show all ]
Length	443
Amino acid sequence	MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQNECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPLKGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFLKILHC
UniProt	P14416
Protein Data Bank	6cm4, 6c38
GPCR-HGmod model	P14416
3D structure model	This structure is from PDB ID 6cm4.
BioLiP	BL0408379, BL0403379
Therapeutic Target Database	T67162
ChEMBL	CHEMBL217
IUPHAR	215
DrugBank	BE0000756

Ligand

Name	Desvenlafaxine
Molecular formula	C16H25NO2
IUPAC name	4-[2-(dimethylamino)-1-(1-hydroxycyclohexyl)ethyl]phenol
Molecular weight	263.381
Hydrogen bond acceptor	3
Hydrogen bond donor	2
XlogP	2.6
Synonyms	AX8123273 CS-2818 Desvenlafaxine [INN:BAN] GTPL7158 Khedezla (TN) O-desmethyl venlafaxine O-Desmethylvenlafaxine, analytical standard (RS)-1-[2-(dimethylamino)-1-(4-hydroxyphenyl)ethyl]cyclohexanol s4113 4-[2-(Dimethylamino)-1-(1-hydroxycyclohexyl)ethyl]phenol # WY 45,233 A844583 AC1L2NUV BR-72949 D07793 dl-o-desmethylvenlafaxin HY-B0602 LS-178212 O-Desmethylvenlafaxine PDSP1_001804 1-[2-(dimethylamino)-1-(4-hydroxyphenyl)ethyl]cyclohexanol SCHEMBL34864 4-[2-dimethylamino-1-(1-hydroxycyclohexyl)ethyl]phenol X4688 AKOS015896311 EC 700-516-2 KB-33580 NCGC00345883-04 O-Desmethylvenlafaxine solution, 1.0 mg/mL in methanol, certified reference material Phenol, 4-[2-(dimethylamino)-1-(1-hydroxycyclohexyl)ethyl]- 4-[1-(1-hydroxycyclohexyl)-2-(dimethylamino)ethyl]phenol SW219514-2 BCP28517 CTK8E8385 desvenlafaxine(o-desnethylvenfaxine) HMS3652K16 KS-00000FZO o-desmethyl venlafaxine-d10 O-Desvenlafaxine (S)-Desmethyl Venlafaxine D6 SB17444 4-[2-(dimethylamino)-1-(1-oxidanylcyclohexyl)ethyl]phenol WY-45,233 AB0031560 ACMC-20ek0k CAS_386750-22-7 D0O3FG DS-1282 I06-2078 MLS006010042 O-DESMETHYLVENLAFAXINE (ODV) PDSP2_001787 1-[2-dimethylamino-1-(4-hydroxyphenyl)ethyl]cyclohexanol SMR004701214 413D628 AT-19352 CHEMBL1118 Desvenlafaxine (INN) FT-0654519 Khedezla NSC_6918664 O-Desmethylvenlafaxine solution, 100 mug/mL in methanol, ampule of 1 mL, certified reference material S-2830 4-[2-(Dimethylamino)-1-(1-hydroxycyclohexyl)ethyl]phenol TR-029259 93413-62-8 BDBM86748 d,l-O-Desmethylvenlafaxine Desvenlafaxine, 97% HSDB 7993 KYYIDSXMWOZKMP-UHFFFAOYSA-N O-desmethyl-venlafaxine ODV 1-[1-(4-hydroxyphenyl)-2-dimethylaminoethyl]cyclohexanol SC-82264 4-[2-Dimethyamino-1-(1-hydroxycyclohexyl)ethyl]phenol Wy-45233 AB01563022_01 AK-72949 CHEBI:83527 DB06700 DVS 233 J10126 MolPort-003-846-411 O-Desmethylvenlafaxine 0.1 mg/ml in Methanol Phenol, 4-(2-(dimethylamino)-1-(1-hydroxycyclohexyl)ethyl)- 4-(2-(Dimethylamino)-1-(1-hydroxycyclohexyl)ethyl)phenol ST2410953 4CH-007182 [ Show all ]
Inchi Key	KYYIDSXMWOZKMP-UHFFFAOYSA-N
Inchi ID	InChI=1S/C16H25NO2/c1-17(2)12-15(13-6-8-14(18)9-7-13)16(19)10-4-3-5-11-16/h6-9,15,18-19H,3-5,10-12H2,1-2H3
PubChem CID	125017
ChEMBL	CHEMBL1118
IUPHAR	N/A
BindingDB	86748
DrugBank	N/A
Structure SDF download
Lipinski's druglikeness	This ligand satisfies Lipinski's rule of five.

Experimental Data

Parameter	Value	Reference	Database source
Ki	<10000.0 nM	PMID16675639	BindingDB

zhanglabzhanggroup.org | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218