You can:
Name | 5-hydroxytryptamine receptor 2C |
---|---|
Species | Homo sapiens (Human) |
Gene | HTR2C |
Synonym | Serotonin receptor 2C serotonin 1c receptor 5-HT1C 5-HT2C 5-HT-2C [ Show all ] |
Disease | Pain Sleep initiation and maintenance disorders; Primary insomnia; Schizophrenia Unspecified Depression Drug abuse [ Show all ] |
Length | 458 |
Amino acid sequence | MVNLRNAVHSFLVHLIGLLVWQCDISVSPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSIVIIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVWPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWAISIGVSVPIPVIGLRDEEKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYVLRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTMQAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVCSGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTNEPVIEKASDNEPGIEMQVENLELPVNPSSVVSERISSV |
UniProt | P28335 |
Protein Data Bank | 6bqg, 6bqh |
GPCR-HGmod model | P28335 |
3D structure model | This structure is from PDB ID 6bqg. |
BioLiP | BL0404805, BL0404806 |
Therapeutic Target Database | T83813 |
ChEMBL | CHEMBL225 |
IUPHAR | 8 |
DrugBank | BE0004957, BE0004881, BE0000533 |
You can:
GLASS ID | Molecule | Formula | Molecular weight | H-bond acceptor / donor | XlogP | Lipinski's druglikeness |
---|---|---|---|---|---|---|
143 | CHEMBL187888 | C13H15N3 | 213.284 | 3 / 1 | 1.6 | Yes |
340 | CHEMBL475382 | C17H19ClN2O | 302.802 | 2 / 3 | N/A | N/A |
489 | CHEMBL54125 | C22H21FN4 | 360.436 | 4 / 0 | 4.7 | Yes |
888 | CHEMBL1933396 | C13H19FN2O2S | 286.365 | 5 / 0 | 1.8 | Yes |
921 | CHEMBL1086755 | C27H32Cl2N4O | 499.48 | 3 / 1 | 5.5 | No |
1027 | CHEMBL2205816 | C18H20N2O | 280.371 | 3 / 1 | 1.8 | Yes |
1264 | CHEMBL493129 | C11H16ClNO | 213.705 | 2 / 2 | N/A | N/A |
1360 | CHEMBL2337104 | C15H19ClN2O | 278.78 | 2 / 3 | N/A | N/A |
1556 | hexachlorophene | C13H6Cl6O2 | 406.889 | 2 / 2 | 7.5 | No |
1651 | CHEMBL479542 | C21H18N4O2 | 358.401 | 4 / 1 | 3.0 | Yes |
1688 | CHEMBL1271756 | C22H30Cl3N5O | 486.866 | 5 / 2 | N/A | N/A |
521496 | CHEMBL3760044 | C18H20N2O3 | 312.369 | 3 / 2 | 3.3 | Yes |
1868 | CHEMBL53662 | C23H23FN4O | 390.462 | 5 / 0 | 4.7 | Yes |
1904 | CHEMBL96732 | C20H23NO | 293.41 | 2 / 0 | 3.6 | Yes |
1908 | CHEMBL329566 | C20H23NO | 293.41 | 2 / 0 | 3.6 | Yes |
1912 | CHEMBL92667 | C20H23NO | 293.41 | 2 / 0 | 3.6 | Yes |
1915 | CHEMBL329268 | C20H23NO | 293.41 | 2 / 0 | 3.6 | Yes |
1917 | CHEMBL327651 | C20H23NO | 293.41 | 2 / 0 | 3.6 | Yes |
1919 | CHEMBL371352 | C20H23NO | 293.41 | 2 / 0 | 3.6 | Yes |
441751 | CHEMBL3416041 | C14H19Cl2NO | 288.212 | 2 / 2 | N/A | N/A |
441753 | CHEMBL3416040 | C14H19Cl2NO | 288.212 | 2 / 2 | N/A | N/A |
2187 | CHEMBL458002 | C29H28ClN5O2 | 514.026 | 5 / 2 | 4.3 | No |
2217 | CHEMBL501896 | C17H17ClF3N | 327.775 | 4 / 2 | N/A | N/A |
2281 | 1-(cyclohexylmethyl)pyrrolidine | C11H21N | 167.296 | 1 / 0 | 3.1 | Yes |
2301 | CHEMBL1271815 | C24H35N5O | 409.578 | 5 / 1 | 4.1 | Yes |
2332 | CHEMBL249797 | C24H28N4O2S | 436.574 | 6 / 2 | 3.9 | Yes |
2917 | CHEMBL446459 | C14H19F2N3O | 283.323 | 4 / 2 | 2.6 | Yes |
2950 | CHEMBL2337496 | C12H13ClN2O | 236.699 | 2 / 2 | 1.4 | Yes |
2993 | RWJ-68354 | C19H15FN4O | 334.354 | 5 / 2 | 3.3 | Yes |
3082 | CHEMBL216050 | C26H29N3O | 399.538 | 3 / 0 | 4.2 | Yes |
521536 | CHEMBL3818805 | C24H27ClN4O | 422.957 | 2 / 2 | 4.8 | Yes |
3164 | CHEMBL175586 | C19H20F3NO2S | 383.429 | 6 / 0 | 4.2 | Yes |
3263 | CHEMBL1084895 | C24H25F3N4O2 | 458.485 | 7 / 1 | 4.1 | Yes |
3408 | CHEMBL1642882 | C18H19ClN4O2S | 390.886 | 5 / 3 | 3.4 | Yes |
3484 | 1,2,3,4-tetrahydropyrazino[1,2-a]indole | C11H12N2 | 172.231 | 1 / 1 | 1.1 | Yes |
3595 | 2-Phenylcyclopropanamine | C9H11N | 133.194 | 1 / 1 | 1.5 | Yes |
3605 | SCHEMBL3561492 | C13H16N2O | 216.284 | 2 / 1 | 1.3 | Yes |
3608 | SCHEMBL3555280 | C13H16N2O | 216.284 | 2 / 1 | 1.3 | Yes |
3616 | CHEMBL360492 | C11H13ClFN | 213.68 | 2 / 1 | 2.8 | Yes |
463333 | CHEMBL3597637 | C25H29ClN4O2 | 452.983 | 5 / 1 | 4.4 | Yes |
4094 | CHEMBL1173578 | C21H16ClN5O2S2 | 469.962 | 7 / 0 | 4.6 | Yes |
4309 | Butanedioic acid, compd. with 5-methoxy-3-(1,2,3,6-tetrahydro-4-pyridinyl)-1H-indole (1:1) | C18H22N2O5 | 346.383 | 6 / 4 | N/A | N/A |
4319 | sulconazole | C18H15Cl3N2S | 397.742 | 2 / 0 | 6.1 | No |
521572 | CHEMBL3735911 | C29H35NO5 | 477.601 | 6 / 0 | 6.2 | No |
4605 | 4-(4-fluorophenyl)piperidine | C11H14FN | 179.238 | 2 / 1 | 2.1 | Yes |
4618 | CHEMBL95112 | C23H27FN2O2S | 414.539 | 6 / 0 | 3.4 | Yes |
4793 | CHEMBL601885 | C30H40N4O3S | 536.735 | 7 / 0 | 5.7 | No |
4809 | CHEMBL376456 | C12H14N2O2 | 218.256 | 3 / 1 | 0.3 | Yes |
4820 | CHEMBL2031733 | C28H27N3O | 421.544 | 3 / 1 | 5.3 | No |
441895 | CHEMBL232206 | C29H26F3N5S | 533.617 | 9 / 0 | 6.2 | No |
4853 | CHEMBL575812 | C13H17N5O3 | 291.311 | 8 / 0 | 1.1 | Yes |
5046 | CHEMBL397112 | C19H12ClF2NO2S | 391.817 | 5 / 0 | 4.8 | Yes |
5105 | CHEMBL55207 | C20H16Cl2N4O2 | 415.274 | 4 / 1 | 4.0 | Yes |
5163 | CHEMBL220521 | C12H13ClN2O2 | 252.698 | 3 / 1 | 0.9 | Yes |
5243 | SB-258719 | C18H30N2O2S | 338.51 | 4 / 0 | 3.5 | Yes |
5261 | CHEMBL299726 | C20H17ClN4O2 | 380.832 | 4 / 1 | 3.5 | Yes |
5521 | UNII-H0EVX3PS4B | C23H30N2O2 | 366.505 | 3 / 0 | 3.7 | Yes |
5748 | AHOUBRCZNHFOSL-UHFFFAOYSA-N | C19H20FNO3 | 329.371 | 5 / 1 | 3.5 | Yes |
5762 | paroxetine | C19H20FNO3 | 329.371 | 5 / 1 | 3.5 | Yes |
5987 | CHEMBL601457 | C27H33N3O2S | 463.64 | 5 / 0 | 5.1 | No |
6063 | CHEMBL273208 | C20H20N2O2 | 320.392 | 4 / 1 | 3.7 | Yes |
6247 | CHEMBL1214659 | C17H19BrF2N4O | 413.267 | 5 / 0 | 2.7 | Yes |
6438 | CHEMBL567587 | C16H16N4O | 280.331 | 4 / 1 | 0.5 | Yes |
6688 | CHEMBL574403 | C17H16ClN7O2S2 | 449.932 | 7 / 3 | 2.7 | Yes |
441964 | CID 118733771 | C15H19ClF3NO3 | 353.766 | 7 / 2 | N/A | N/A |
441966 | CID 118733773 | C15H19ClF3NO3 | 353.766 | 7 / 2 | N/A | N/A |
6754 | CHEMBL213817 | C27H27FN4O | 442.538 | 5 / 1 | 4.2 | Yes |
6762 | CHEMBL404581 | C21H20FN3 | 333.41 | 4 / 1 | 3.7 | Yes |
6802 | CHEMBL577831 | C17H21ClN4O | 332.832 | 4 / 1 | 1.7 | Yes |
441975 | CHEMBL3358498 | C24H27FN4O | 406.505 | 5 / 1 | 4.2 | Yes |
463720 | CHEMBL3633757 | C26H24BrNO4 | 494.385 | 5 / 0 | 5.4 | No |
6985 | CHEMBL493129 | C11H15NO | 177.247 | 2 / 1 | 1.4 | Yes |
536133 | CHEMBL3899832 | C22H19N5O4 | 417.425 | 8 / 2 | 3.6 | Yes |
7072 | CHEMBL109673 | C22H24FNO2S | 385.497 | 5 / 0 | 4.1 | Yes |
7143 | CHEMBL234532 | C23H26Cl2N2O3 | 449.372 | 4 / 0 | 5.0 | Yes |
7156 | SCHEMBL2683101 | C28H39Cl2N5O | 532.554 | 4 / 3 | N/A | No |
7263 | CHEMBL54914 | C15H17N5 | 267.336 | 4 / 0 | 2.4 | Yes |
7315 | CHEMBL543613 | C22H24ClFN2O2S | 434.954 | 6 / 1 | N/A | N/A |
7375 | CHEMBL3286559 | C15H18N4 | 254.337 | 4 / 2 | 1.7 | Yes |
7505 | 67259-63-6 | C12H14F3N | 229.246 | 4 / 1 | 2.9 | Yes |
7596 | CHEMBL233440 | C26H31N3O4 | 449.551 | 5 / 1 | 3.3 | Yes |
7687 | CHEMBL494702 | C25H28FNO5 | 441.499 | 7 / 0 | 3.9 | Yes |
7698 | 792173-99-0 | C17H13N5O2 | 319.324 | 5 / 2 | 2.0 | Yes |
7855 | CHEMBL63114 | C14H15N3S | 257.355 | 3 / 0 | 4.2 | Yes |
8112 | CHEMBL317333 | C26H24FN5 | 425.511 | 5 / 0 | 4.0 | Yes |
8197 | BW-723C86 | C16H18N2OS | 286.393 | 3 / 2 | 3.0 | Yes |
521699 | CHEMBL3754496 | C16H19FN2 | 258.34 | 2 / 1 | 2.9 | Yes |
8660 | N-(4-fluorophenyl)-6-(morpholin-4-yl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine | C15H15FN6O | 314.324 | 7 / 2 | 2.2 | Yes |
536193 | CHEMBL3947432 | C14H20N2O | 232.327 | 3 / 1 | 2.2 | Yes |
8893 | CHEMBL475383 | C17H18ClN3O | 315.801 | 2 / 3 | 2.6 | Yes |
8912 | CHEMBL181324 | C12H17NO | 191.274 | 2 / 1 | 2.1 | Yes |
8948 | CHEMBL240665 | C19H13F2NO2S | 357.375 | 5 / 0 | 4.2 | Yes |
9078 | CHEMBL567246 | C24H28ClN5O3 | 469.97 | 5 / 3 | 3.0 | Yes |
9432 | CHEMBL2397891 | C15H18N2O | 242.322 | 2 / 1 | 1.7 | Yes |
9549 | GSK163090 | C25H29N5O | 415.541 | 4 / 1 | 3.4 | Yes |
9596 | SCHEMBL1080293 | C25H28Cl2FN5O | 504.431 | 5 / 1 | 5.4 | No |
9615 | CHEMBL418678 | C20H19FN4S | 366.458 | 5 / 0 | 4.7 | Yes |
9722 | CHEMBL394729 | C19H14FNO2S | 339.384 | 4 / 0 | 4.1 | Yes |
9833 | CHEMBL215131 | C27H25FN4O2 | 456.521 | 6 / 1 | 3.1 | Yes |
9875 | AC-42 | C20H31NO | 301.474 | 2 / 0 | 5.2 | No |
zhanglabzhanggroup.org | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218