D-I-TASSER O95744

D-I-TASSER results for O95744

[Click result.zip to download all results on this page]

Summary of the Protein

Uniprot ID: O95744
Protein Name: Putative postmeiotic segregation increased 2-like protein 2
Gene Name: PMS2P2

Input Sequence in FASTA format

>O95744 (297 residues)
MGESSRKPPTPTPEGPTVSVKQLFSTLPVRHKEFQRNIKKKRACFPFAFCRDCQFLEGSP
AMLPVQPAKLTEPAKAIKPIDRKSVHQICSGPVVLSLSTAVKKIVGNSLDAGATNIDLKL
KDYGMDLIEVSGNGCGVEEENFEGLSLSALKHHTSKIREFADLTRVETFGFQGKALSSLC
ALSDVTISTCHVSAKVGTRLVFDHDGKIIKKTPYPHPRGTTVSVKQLFSTLPVRHKEFQR
NIKKKRACFPFAFCRDCQFLEGSPAMLPVQPAKLTVTGELRACRSWKTREGITEAVG

Predicted Contact and Distance Map Used in D-I-TASSER simulation

Contact Map

Distance Map

D-I-TASSER simulation is guided by the consensus contact map (left figure) and distance map (right figure) derived based on confidence scores of DeepPotential. In the contact, distance map and hydrogen bond networks, the axes mark the residue index along the sequence. For the contact map, each dot represents a residue pair with predicted contact, while for the distance map and hydrogen bond network, a color scale represents a distance of 1-20+ angstroms or a angle of 0-180 degree.

Information of Domain

No. of Domain	Domain	Domain Boundary	Length of Domain	Models of Domain	Sequence
1	O95744-D1	1-297	297		MGESSRKPPTPTPEGPTVSVKQLFSTLPVRHKEFQRNIKKKRACFPFAFCRDCQFLEGSPAMLPVQPAKLTEPAKAIKPIDRKSVHQICSGPVVLSLSTAVKKIVGNSLDAGATNIDLKLKDYGMDLIEVSGNGCGVEEENFEGLSLSALKHHTSKIREFADLTRVETFGFQGKALSSLCALSDVTISTCHVSAKVGTRLVFDHDGKIIKKTPYPHPRGTTVSVKQLFSTLPVRHKEFQRNIKKKRACFPFAFCRDCQFLEGSPAMLPVQPAKLTVTGELRACRSWKTREGITEAVG

Top 1 final models from D-I-TASSER

Click to view	Rank^a	Download	Estimated TM-score^b
	1	model1.pdb.gz	0.632

(a)

D-I-TASSER simulations generate a large ensemble of structural conformations, i.e. decoys. These decoys are clustered by SPICKER based on pairwise structure similarity to report up to five final models from the five largest clusters. Models are ranked in descending order of cluster size. If the simulations converge well, it is possible to have less than 5 models generated, which is usually an indication of good model quality.

(b)

The model confidence is quantitatified by estimated TM-score (eTM-score), calculated based on significance of threading template alignments, contact map satisfaction rate, mean absolute error between distance of model and distance of DeepPotential, and convergence of D-I-TASSER simulations. eTM-score is typically in the range of [0, 1], with higher eTM-score signifies higher model confidence.

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	1nhjA	0.62	2.60	0.268	0.690	model1_1nhjA.pdb.gz
2	3na3A	0.59	2.89	0.241	0.673	model1_3na3A.pdb.gz
3	3h4lB	0.57	3.07	0.333	0.643	model1_3h4lB.pdb.gz
4	2q2eB	0.52	3.47	0.150	0.620	model1_2q2eB.pdb.gz
5	1h7sA	0.51	3.26	0.642	0.589	model1_1h7sA.pdb.gz
6	2zbkB	0.49	3.66	0.162	0.606	model1_2zbkB.pdb.gz
7	1ah6A	0.44	3.80	0.101	0.545	model1_1ah6A.pdb.gz
8	1gkzA	0.34	3.66	0.109	0.407	model1_1gkzA.pdb.gz
9	3dgeA	0.31	4.25	0.081	0.397	model1_3dgeA.pdb.gz
10	3sl2A	0.28	3.13	0.096	0.327	model1_3sl2A.pdb.gz

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0003677	1.00	DNA binding
GO:0016887	0.95	ATPase activity
GO:0003697	0.95	single-stranded DNA binding

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0050896	0.99	response to stimulus
GO:0009987	0.99	cellular process
GO:0006298	0.98	mismatch repair

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0044424	1.00	intracellular part
GO:0043234	0.99	protein complex
GO:0032300	0.98	mismatch repair complex
GO:0044446	0.89	intracellular organelle part
GO:0044428	0.88	nuclear part
GO:0032389	0.74	MutLalpha complex

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted Enzyme Commission (EC) Numbers

Top 5 enzyme homologs in PDB

Rank	Cscore^EC	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	EC Number	Predicted Active Site Residues
1	0.203	3g75A	0.458	3.15	0.160	0.542	5.99.1.3	107,110,111,113,177,220
2	0.202	1kznA	0.482	3.10	0.129	0.569	5.99.1.3	111,220
3	0.060	1gthA	0.306	6.70	0.029	0.545	1.3.1.2	NA
4	0.060	1zxnC	0.527	3.80	0.121	0.670	5.99.1.3	133
5	0.060	5coxA	0.341	6.48	0.047	0.583	1.14.99.1	NA

	Click on the radio buttons to visualize predicted active site residues.
(a)	Cscore^EC is the confidence score for the Enzyme Commission (EC) number prediction. Cscore^EC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Ligand Binding Sites

Template proteins with similar binding site:

Rank	Cscore^LB	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	BS-score	Lig. Name	Download Complex	Predicted binding site residues
1	0.81	1ea6B	0.519	2.91	0.655	0.583	1.69	ADP	complex1.pdb.gz	107,111,132,137,145,174,175,176,220
2	0.45	2zbkB	0.494	3.66	0.162	0.606	1.20	RDC	complex2.pdb.gz	104,108,111,132,135,136,137,220,222
3	0.39	3g75B	0.458	3.01	0.173	0.539	1.18	B48	complex3.pdb.gz	104,108,132,135,138,222
4	0.39	2wi1A	0.447	3.69	0.146	0.542	1.13	ZZ2	complex4.pdb.gz	107,108,111,132,135
5	0.35	2wi2A	0.446	3.73	0.146	0.542	1.20	ZZ3	complex5.pdb.gz	110,132,135,136,137,220
6	0.16	2yebA	0.446	3.72	0.146	0.542	1.21	2K4	complex6.pdb.gz	104,107,111,132,137,220
7	0.13	2wi3A	0.446	3.72	0.146	0.542	0.99	ZZ3	complex7.pdb.gz	104,107,111,131,136,145,220,222
8	0.12	3g7eA	0.503	3.16	0.130	0.596	0.84	B46	complex8.pdb.gz	104,107,108,110,132,135,136,137,138,176,185,191,222
9	0.12	2wi4A	0.444	3.52	0.146	0.535	0.88	ZZ4	complex9.pdb.gz	107,108,132,137,141,187,220
10	0.10	3k99B	0.446	3.77	0.135	0.545	0.84	PFT	complex10.pdb.gz	103,104,106,107,110,130,222,224

	Click on the radio buttons to visualize predicted binding site and residues.
(a)	Cscore^LB is the confidence score of predicted binding site. Cscore^LB values range in between [0-1]; where a higher score indicates a more reliable ligand-binding site prediction.
(b)	BS-score is a measure of local similarity (sequence & structure) between template binding site and predicted binding site in the query structure. Based on large scale benchmarking analysis, we have observed that a BS-score >1 reflects a significant local match between the predicted and template binding site.
(c)	TM-score is a measure of global structural similarity between query and template protein.
(d)	RMSD^a the RMSD between residues that are structurally aligned by TM-align.
(e)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(f)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

[Click result.zip to download all results on this page]

References:
1.	Wei Zheng, Qiqige Wuyun, Yang Li, Quancheng Liu, Xiaogen Zhou, Yiheng Zhu, P. Lydia Freddolino, Yang Zhang. Integrating deep learning potentials with I-TASSER for single- and multi-domain protein structure prediction. Submitted. 2023.