D-I-TASSER P02652

D-I-TASSER results for P02652

[Click result.zip to download all results on this page]

Summary of the Protein

Uniprot ID: P02652
Protein Name: Apolipoprotein A-II
Gene Name: APOA2

Input Sequence in FASTA format

>P02652 (100 residues)
MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAE
AKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ

Predicted Contact and Distance Map Used in D-I-TASSER simulation

Contact Map

Distance Map

D-I-TASSER simulation is guided by the consensus contact map (left figure) and distance map (right figure) derived based on confidence scores of DeepPotential. In the contact, distance map and hydrogen bond networks, the axes mark the residue index along the sequence. For the contact map, each dot represents a residue pair with predicted contact, while for the distance map and hydrogen bond network, a color scale represents a distance of 1-20+ angstroms or a angle of 0-180 degree.

Information of Domain

No. of Domain	Domain	Domain Boundary	Length of Domain	Models of Domain	Sequence
1	P02652-D1	1-100	100		MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ

Top 1 final models from D-I-TASSER

Click to view	Rank^a	Download	Estimated TM-score^b
	1	model1.pdb.gz	0.4733

(a)

D-I-TASSER simulations generate a large ensemble of structural conformations, i.e. decoys. These decoys are clustered by SPICKER based on pairwise structure similarity to report up to five final models from the five largest clusters. Models are ranked in descending order of cluster size. If the simulations converge well, it is possible to have less than 5 models generated, which is usually an indication of good model quality.

(b)

The model confidence is quantitatified by estimated TM-score (eTM-score), calculated based on significance of threading template alignments, contact map satisfaction rate, mean absolute error between distance of model and distance of DeepPotential, and convergence of D-I-TASSER simulations. eTM-score is typically in the range of [0, 1], with higher eTM-score signifies higher model confidence.

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	6at7B	0.63	3.68	0.061	0.970	model1_6at7B.pdb.gz
2	4a01A	0.63	3.56	0.042	0.950	model1_4a01A.pdb.gz
3	1w27A	0.63	3.71	0.091	0.970	model1_1w27A.pdb.gz
4	5tgzA	0.62	3.39	0.091	0.910	model1_5tgzA.pdb.gz
5	6ko5A2	0.61	3.51	0.082	0.890	model1_6ko5A2.pdb.gz
6	3nz4A	0.61	3.75	0.121	0.960	model1_3nz4A.pdb.gz
7	1y2mB	0.61	3.80	0.082	0.940	model1_1y2mB.pdb.gz
8	6iiuA2	0.61	3.22	0.102	0.870	model1_6iiuA2.pdb.gz
9	2nyfA2	0.57	3.96	0.081	0.900	model1_2nyfA2.pdb.gz
10	2rjsB2	0.56	3.71	0.040	0.870	model1_2rjsB2.pdb.gz

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0097159	0.92	organic cyclic compound binding
GO:0043169	0.91	cation binding
GO:0036094	0.91	small molecule binding
GO:0008289	0.91	lipid binding
GO:0031210	0.90	phosphatidylcholine binding
GO:0030234	0.90	enzyme regulator activity
GO:0017127	0.90	cholesterol transporter activity
GO:0015485	0.90	cholesterol binding
GO:0044877	0.88	macromolecular complex binding
GO:0005102	0.88	receptor binding
GO:0070653	0.87	high-density lipoprotein particle receptor binding
GO:0055102	0.87	lipase inhibitor activity
GO:0034190	0.87	apolipoprotein receptor binding
GO:0008035	0.87	high-density lipoprotein particle binding
GO:0046983	0.62	protein dimerization activity
GO:0046982	0.61	protein heterodimerization activity

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0044763	1.00	single-organism cellular process
GO:0008152	0.96	metabolic process
GO:0071704	0.94	organic substance metabolic process
GO:0044710	0.94	single-organism metabolic process
GO:0044238	0.93	primary metabolic process
GO:0043170	0.93	macromolecule metabolic process
GO:0065007	0.88	biological regulation
GO:0044281	0.81	small molecule metabolic process
GO:1901360	0.76	organic cyclic compound metabolic process
GO:0065008	0.76	regulation of biological quality
GO:0006629	0.76	lipid metabolic process
GO:0060191	0.75	regulation of lipase activity
GO:0042632	0.75	cholesterol homeostasis
GO:0042157	0.75	lipoprotein metabolic process
GO:0034380	0.75	high-density lipoprotein particle assembly
GO:0034370	0.75	triglyceride-rich lipoprotein particle remodeling
GO:0008203	0.75	cholesterol metabolic process
GO:0044092	0.73	negative regulation of molecular function
GO:0060192	0.72	negative regulation of lipase activity
GO:0034375	0.72	high-density lipoprotein particle remodeling
GO:0034374	0.72	low-density lipoprotein particle remodeling
GO:0050789	0.64	regulation of biological process
GO:0050794	0.62	regulation of cellular process
GO:0048518	0.58	positive regulation of biological process
GO:0031323	0.58	regulation of cellular metabolic process
GO:0080090	0.57	regulation of primary metabolic process
GO:0048522	0.57	positive regulation of cellular process
GO:0044237	0.57	cellular metabolic process
GO:0031325	0.56	positive regulation of cellular metabolic process
GO:0051239	0.55	regulation of multicellular organismal process
GO:0031326	0.55	regulation of cellular biosynthetic process
GO:0060255	0.54	regulation of macromolecule metabolic process
GO:0031328	0.54	positive regulation of cellular biosynthetic process
GO:0010604	0.53	positive regulation of macromolecule metabolic process
GO:0051246	0.52	regulation of protein metabolic process
GO:0010557	0.52	positive regulation of macromolecule biosynthetic process
GO:0051247	0.51	positive regulation of protein metabolic process
GO:0051240	0.51	positive regulation of multicellular organismal process
GO:0045416	0.50	positive regulation of interleukin-8 biosynthetic process
GO:0044260	0.50	cellular macromolecule metabolic process

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0072562	1.00	blood microparticle
GO:0042627	1.00	chylomicron
GO:0034364	1.00	high-density lipoprotein particle
GO:0034366	0.97	spherical high-density lipoprotein particle
GO:0034361	0.97	very-low-density lipoprotein particle
GO:0044464	0.66	cell part
GO:0044424	0.60	intracellular part

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted Enzyme Commission (EC) Numbers

Top 5 enzyme homologs in PDB

Rank	Cscore^EC	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	EC Number	Predicted Active Site Residues
1	0.060	1uzrB	0.573	3.52	0.061	0.880	1.17.4.1	37
2	0.060	2dh4A	0.552	3.59	0.115	0.860	2.5.1.29	NA
3	0.060	1fpsA	0.550	3.59	0.066	0.850	2.5.1.1 2.5.1.10	NA
4	0.060	1xvgC	0.601	3.54	0.042	0.890	1.14.13.25	NA
5	0.060	1rqiA	0.537	3.72	0.063	0.850	2.5.1.10	NA

	Click on the radio buttons to visualize predicted active site residues.
(a)	Cscore^EC is the confidence score for the Enzyme Commission (EC) number prediction. Cscore^EC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Ligand Binding Sites

Template proteins with similar binding site:

Rank	Cscore^LB	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	BS-score	Lig. Name	Download Complex	Predicted binding site residues
1	0.05	3nz4A	0.612	3.75	0.121	0.960	0.13	TCA	complex1.pdb.gz	44,50,51
2	0.03	1xvgA	0.597	3.33	0.072	0.890	0.33	BRJ	complex2.pdb.gz	44,47,48,51
3	0.01	1xvgB	0.601	3.49	0.061	0.900	0.40	BRJ	complex3.pdb.gz	37,41,42,45

	Click on the radio buttons to visualize predicted binding site and residues.
(a)	Cscore^LB is the confidence score of predicted binding site. Cscore^LB values range in between [0-1]; where a higher score indicates a more reliable ligand-binding site prediction.
(b)	BS-score is a measure of local similarity (sequence & structure) between template binding site and predicted binding site in the query structure. Based on large scale benchmarking analysis, we have observed that a BS-score >1 reflects a significant local match between the predicted and template binding site.
(c)	TM-score is a measure of global structural similarity between query and template protein.
(d)	RMSD^a the RMSD between residues that are structurally aligned by TM-align.
(e)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(f)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

[Click result.zip to download all results on this page]

References:
1.	Wei Zheng, Qiqige Wuyun, Yang Li, Quancheng Liu, Xiaogen Zhou, Yiheng Zhu, P. Lydia Freddolino, Yang Zhang. Integrating deep learning potentials with I-TASSER for single- and multi-domain protein structure prediction. Submitted. 2023.