D-I-TASSER P13349

D-I-TASSER results for P13349

[Click result.zip to download all results on this page]

Summary of the Protein

Uniprot ID: P13349
Protein Name: Myogenic factor 5
Gene Name: MYF5

Input Sequence in FASTA format

>P13349 (255 residues)
MDVMDGCQFSPSEYFYDGSCIPSPEGEFGDEFVPRVAAFGAHKAELQGSDEDEHVRAPTG
HHQAGHCLMWACKACKRKSTTMDRRKAATMRERRRLKKVNQAFETLKRCTTTNPNQRLPK
VEILRNAIRYIESLQELLREQVENYYSLPGQSCSEPTSPTSNCSDGMPECNSPVWSRKSS
TFDSIYCPDVSNVYATDKNSLSSLDCLSNIVDRITSSEQPGLPLQDLASLSPVASTDSQP
ATPGASSSRLIYHVL

Predicted Contact and Distance Map Used in D-I-TASSER simulation

Contact Map

Distance Map

D-I-TASSER simulation is guided by the consensus contact map (left figure) and distance map (right figure) derived based on confidence scores of DeepPotential. In the contact, distance map and hydrogen bond networks, the axes mark the residue index along the sequence. For the contact map, each dot represents a residue pair with predicted contact, while for the distance map and hydrogen bond network, a color scale represents a distance of 1-20+ angstroms or a angle of 0-180 degree.

Information of Domain

No. of Domain	Domain	Domain Boundary	Length of Domain	Models of Domain	Sequence
1	P13349-D1	1-255	255		MDVMDGCQFSPSEYFYDGSCIPSPEGEFGDEFVPRVAAFGAHKAELQGSDEDEHVRAPTGHHQAGHCLMWACKACKRKSTTMDRRKAATMRERRRLKKVNQAFETLKRCTTTNPNQRLPKVEILRNAIRYIESLQELLREQVENYYSLPGQSCSEPTSPTSNCSDGMPECNSPVWSRKSSTFDSIYCPDVSNVYATDKNSLSSLDCLSNIVDRITSSEQPGLPLQDLASLSPVASTDSQPATPGASSSRLIYHVL

Top 1 final models from D-I-TASSER

Click to view	Rank^a	Download	Estimated TM-score^b
	1	model1.pdb.gz	0.4238

(a)

D-I-TASSER simulations generate a large ensemble of structural conformations, i.e. decoys. These decoys are clustered by SPICKER based on pairwise structure similarity to report up to five final models from the five largest clusters. Models are ranked in descending order of cluster size. If the simulations converge well, it is possible to have less than 5 models generated, which is usually an indication of good model quality.

(b)

The model confidence is quantitatified by estimated TM-score (eTM-score), calculated based on significance of threading template alignments, contact map satisfaction rate, mean absolute error between distance of model and distance of DeepPotential, and convergence of D-I-TASSER simulations. eTM-score is typically in the range of [0, 1], with higher eTM-score signifies higher model confidence.

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	6qp6A	0.46	5.73	0.072	0.757	model1_6qp6A.pdb.gz
2	7by5A	0.46	5.80	0.056	0.745	model1_7by5A.pdb.gz
3	6rutB1	0.45	6.14	0.054	0.784	model1_6rutB1.pdb.gz
4	7b5cA	0.45	5.81	0.044	0.761	model1_7b5cA.pdb.gz
5	6rc9A	0.45	6.14	0.067	0.784	model1_6rc9A.pdb.gz
6	6wc3A	0.45	5.61	0.087	0.718	model1_6wc3A.pdb.gz
7	5oc9A	0.45	5.47	0.040	0.710	model1_5oc9A.pdb.gz
8	3ksyA	0.45	5.41	0.042	0.702	model1_3ksyA.pdb.gz
9	4y21A	0.44	5.33	0.070	0.694	model1_4y21A.pdb.gz
10	4d8mA	0.44	5.66	0.034	0.714	model1_4d8mA.pdb.gz

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:1901363	0.97	heterocyclic compound binding
GO:0097159	0.97	organic cyclic compound binding
GO:0003677	0.96	DNA binding
GO:0044212	0.94	transcription regulatory region DNA binding
GO:0003700	0.93	transcription factor activity, sequence-specific DNA binding
GO:0043565	0.87	sequence-specific DNA binding
GO:0003690	0.87	double-stranded DNA binding
GO:0000977	0.86	RNA polymerase II regulatory region sequence-specific DNA binding
GO:0000981	0.79	RNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001228	0.62	transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0000978	0.62	RNA polymerase II core promoter proximal region sequence-specific DNA binding
GO:0003705	0.60	transcription factor activity, RNA polymerase II distal enhancer sequence-specific binding

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0065007	0.93	biological regulation
GO:0050789	0.93	regulation of biological process
GO:0050794	0.92	regulation of cellular process
GO:0044699	0.87	single-organism process
GO:0009987	0.86	cellular process
GO:0048518	0.81	positive regulation of biological process
GO:0048522	0.80	positive regulation of cellular process
GO:0044763	0.79	single-organism cellular process
GO:0048869	0.76	cellular developmental process
GO:0050793	0.73	regulation of developmental process
GO:0051239	0.71	regulation of multicellular organismal process
GO:0045595	0.71	regulation of cell differentiation
GO:2000026	0.70	regulation of multicellular organismal development
GO:0030154	0.69	cell differentiation
GO:0051094	0.67	positive regulation of developmental process
GO:0060284	0.66	regulation of cell development
GO:0045597	0.66	positive regulation of cell differentiation
GO:0051240	0.63	positive regulation of multicellular organismal process
GO:0051128	0.61	regulation of cellular component organization
GO:0010720	0.61	positive regulation of cell development
GO:0051130	0.60	positive regulation of cellular component organization
GO:0022603	0.60	regulation of anatomical structure morphogenesis
GO:1901739	0.59	regulation of myoblast fusion
GO:0045663	0.59	positive regulation of myoblast differentiation
GO:0010831	0.59	positive regulation of myotube differentiation
GO:1901741	0.58	positive regulation of myoblast fusion
GO:0016202	0.57	regulation of striated muscle tissue development
GO:0048641	0.56	regulation of skeletal muscle tissue development
GO:0048743	0.55	positive regulation of skeletal muscle fiber development
GO:0035914	0.55	skeletal muscle cell differentiation
GO:0019222	0.52	regulation of metabolic process
GO:0060255	0.51	regulation of macromolecule metabolic process
GO:0031323	0.51	regulation of cellular metabolic process
GO:0080090	0.50	regulation of primary metabolic process
GO:0032502	0.50	developmental process

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0044424	1.00	intracellular part
GO:0043229	0.93	intracellular organelle
GO:0043231	0.90	intracellular membrane-bounded organelle
GO:0005634	0.89	nucleus

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted Enzyme Commission (EC) Numbers

Top 5 enzyme homologs in PDB

Rank	Cscore^EC	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	EC Number	Predicted Active Site Residues
1	0.060	3fbvD	0.385	5.82	0.046	0.639	2.7.11.1	NA
2	0.060	1s4bP	0.394	5.72	0.058	0.620	3.4.24.15	NA
3	0.060	1y791	0.399	5.47	0.045	0.627	3.4.15.5	NA
4	0.060	1gthA	0.265	6.49	0.028	0.474	1.3.1.2	236
5	0.060	2pdaA	0.379	5.60	0.042	0.612	1.2.7.1	NA

	Click on the radio buttons to visualize predicted active site residues.
(a)	Cscore^EC is the confidence score for the Enzyme Commission (EC) number prediction. Cscore^EC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Ligand Binding Sites

Template proteins with similar binding site:

Click to view	Rank	Cscore^LB	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	BS-score	Lig. Name	Download Complex	Predicted binding site residues
	1	0.01	2nm1A	0.287	6.42	0.039	0.518	0.10	III	complex1.pdb.gz	92,93,166,167

	Click on the radio buttons to visualize predicted binding site and residues.
(a)	Cscore^LB is the confidence score of predicted binding site. Cscore^LB values range in between [0-1]; where a higher score indicates a more reliable ligand-binding site prediction.
(b)	BS-score is a measure of local similarity (sequence & structure) between template binding site and predicted binding site in the query structure. Based on large scale benchmarking analysis, we have observed that a BS-score >1 reflects a significant local match between the predicted and template binding site.
(c)	TM-score is a measure of global structural similarity between query and template protein.
(d)	RMSD^a the RMSD between residues that are structurally aligned by TM-align.
(e)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(f)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

[Click result.zip to download all results on this page]

References:
1.	Wei Zheng, Qiqige Wuyun, Yang Li, Quancheng Liu, Xiaogen Zhou, Yiheng Zhu, P. Lydia Freddolino, Yang Zhang. Integrating deep learning potentials with I-TASSER for single- and multi-domain protein structure prediction. Submitted. 2023.