D-I-TASSER Q63HQ2-D2

D-I-TASSER results for Q63HQ2-D2

[Click result.zip to download all results on this page]

Input Sequence in FASTA format

>Q63HQ2 (126 residues)
RLFDMPCDETLCSADSFCVNDYTWGGSRCQCTLGKGGESCSESSGICDEASCIHGGTCTA
IKADSYICLCPLGFKGRHCEDANAAHPCVRAPCAHGGSCRPRKEGYDCDCPLGFEGLHCQ
KECGNY

Predicted Secondary Structure

Sequence	20 40 60 80 100 120 \| \| \| \| \| \| RLFDMPCDETLCSADSFCVNDYTWGGSRCQCTLGKGGESCSESSGICDEASCIHGGTCTAIKADSYICLCPLGFKGRHCEDANAAHPCVRAPCAHGGSCRPRKEGYDCDCPLGFEGLHCQKECGNY
Prediction	CCCCCCCCCCCCCCCCSSSCCCCCCCSSSSCCCCCSCCCCCCCCCCCCCCCCCCCCSSSCCCCCCSSSSCCCCCSCCCCCCCCCCCCCCCCCCCCCCSSSCCCCCSSSSCCCCCSCCCCCCCCCCC
Confidence	971688989998899588457889856988499953487612567688998889968861899847988589961587756777577989987899688847994796759985258856468999
	H:Helix; S:Strand; C:Coil

Predicted Solvent Accessibility

Sequence	20 40 60 80 100 120 \| \| \| \| \| \| RLFDMPCDETLCSADSFCVNDYTWGGSRCQCTLGKGGESCSESSGICDEASCIHGGTCTAIKADSYICLCPLGFKGRHCEDANAAHPCVRAPCAHGGSCRPRKEGYDCDCPLGFEGLHCQKECGNY
Prediction	724616456414434023334644541314246345474144623464531441302133474530313146344164144444214047314424012324454041413545515424552468
	Values range from 0 (buried residue) to 8 (highly exposed residue)

Predicted Contact, Hydrogen and Distance Map Used in D-I-TASSER simulation

Contact Map

Distance Map

Hydrogen bond networks

D-I-TASSER simulation is guided by the consensus contact map (left figure), distance map (middle figure) and Hydrogen bond network (right figure) derived based on confidence scores of DeepPotential. In the contact, distance map and hydrogen bond networks, the axes mark the residue index along the sequence. For the contact map, each dot represents a residue pair with predicted contact, while for the distance map and hydrogen bond network, a color scale represents a distance of 1-20+ angstroms or a angle of 0-180 degree.

Top 10 threading templates used by D-I-TASSER

Rank

PDB
hit

ID1

ID2

Cov

Norm.
Zscore

Download
alignment

                  20                  40                  60                  80                 100                 120

                   |                   |                   |                   |                   |                   |

SS
Seq

CCCCCCCCCCCCCCCCSSSCCCCCCCSSSSCCCCCSCCCCCCCCCCCCCCCCCCCCSSSCCCCCCSSSSCCCCCSCCCCCCCCCCCCCCCCCCCCCCSSSCCCCCSSSSCCCCCSCCCCCCCCCCC
RLFDMPCDETLCSADSFCVNDYTWGGSRCQCTLGKGGESCSESSGICDEASCIHGGTCTAIKADSYICLCPLGFKGRHCEDANAAHPCVRAPCAHGGSCRPRKEGYDCDCPLGFEGLHCQKECGNY

5uk5A

0.17

0.16

5.21

1.00

DEthreader

CSENIDDCASAACFATCHDRV-----ASFYCECRTGL--LCHLNDACIS-NPCNEGSNCDTNPVGAICTCPSGYTGPACSQ-DVDECALANPCEHAGKCLNTLGSFECQCLQ-GYTGRCEDQIGEF

2vj3A

0.31

0.29

8.65

3.71

SPARKS-K

-QDVDECSANPCEHAGKCINTL--GSFECQCLQGYTGPRCEIDVNECVSNPCQNDATCLDQIGE-FQCICMPGYEGVHCEV--NTDECASSPCLHNGRCLDKINEFQCECPTGFTGHLCQVDLH--

5uk5A

0.27

0.25

7.79

0.82

MapAlign

--LNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECAANPCEHAGKCLNTLGS-FECQCLQGYTGPRCEIDV--NECISNPCQNDATCLDQIGEFQCICMPGYEGVYCESGR---

5uk5A

0.28

0.26

8.02

0.72

CEthreader

CHLNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECGANPCEHAGKCLNT-LGSFECQCLQGYTGPRCEIDV--NECISNPCQNDATCLDQIGEFQCICMPGYEGVYCESGR---

4xbmB

0.35

0.34

10.18

2.22

MUSTER

NQDLNYCTHKPCKNGATCTNTG-QGSYTCSCRPGYTGATCELGIDECDPSPCKNGGSCTDL-ENSYSCTCPPGFYGKICE--LSAMTCADGPCFNGGRCSDSPGGYSCRCPVGYSGFNCEKKIDYS

4xbmB

0.35

0.34

10.18

1.62

HHsearch

NQDLNYCTHKPCKNGATCTNT-GQGSYTCSCRPGYTGATCELGIDECDPSPCKNGGSCTDL-ENSYSCTCPPGFYGKICELS--AMTCADGPCFNGGRCSDSPDGYSCRCPVGYSGFNCEKKISSP

2vj3A

0.31

0.29

8.64

1.14

FFAS-3D

--DVDECSANPCEHAGKCI--NTLGSFECQCLQGYTGPRCEIDVNECVSNPCQNDATCLDQIGE-FQCICMPGYEGVHCEVNTD--ECASSPCLHNGRCLDKINEFQCECPTGFTGHLCQVDLH--

2vj3A

0.29

0.28

8.44

1.07

EigenThreader

DVDECSLGANPCEHAGKCINTL--GSFECQCLQGYTGPRCEIDVNECVSNPCQNDATCLDQ-IGEFQCICMPGYEGVHCEVNTD--ECASSPCLHNGRCLDKINEFQCECPTGFTGHLCQVDLH--

5uk5A

0.28

0.26

8.02

3.92

CNFpred

CHLNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECAANPCEHAGKCLNTL-GSFECQCLQGYTGPRCE--IDVNECISNPCQNDATCLDQIGEFQCICMPGYEGVYCESGR---

2vj3A

0.30

0.23

6.99

1.00

DEthreader

---LGAN--PCE---HA-------------C-QGYTG-RCEIDVNECVSNPCQNDATCLDQ-IGEFQCICMPGYEGVHCEV--NTDECASSPCLHNGRCLDKINEFQCECPTGFTGHLCQVDLH--

(a)	ID1 is the number of template residues identical to query divided by number of aligned residues.
(b)	ID2 is the number of template residues identical to query divided by query sequence length.
(c)	Cov is equal the number of aligned template residues divided by query sequence length.
(d)	Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold.
(e)	Download alignment lists the threading program used to identify the template, and provide the 3D structure of aligned regions of threading templates (threading[1-10].pdb.gz).
(f)	Template residues identical to query sequence are highlighted in color.

Top 1 final models from D-I-TASSER

Click to view	Rank^a	Download	Estimated TM-score^b
	1	model1.pdb.gz	0.6219

(a)

D-I-TASSER simulations generate a large ensemble of structural conformations, i.e. decoys. These decoys are clustered by SPICKER based on pairwise structure similarity to report up to five final models from the five largest clusters. Models are ranked in descending order of cluster size. If the simulations converge well, it is possible to have less than 5 models generated, which is usually an indication of good model quality.

(b)

The model confidence is quantitatified by estimated TM-score (eTM-score), calculated based on significance of threading template alignments, contact map satisfaction rate, mean absolute error between distance of model and distance of DeepPotential, and convergence of D-I-TASSER simulations. eTM-score is typically in the range of [0, 1], with higher eTM-score signifies higher model confidence.

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	5uk5A	0.84	1.63	0.275	0.952	model1_5uk5A.pdb.gz
2	5mwbA	0.80	1.69	0.330	0.913	model1_5mwbA.pdb.gz
3	2vj3A	0.76	2.41	0.294	0.944	model1_2vj3A.pdb.gz
4	4xbmB	0.64	3.44	0.273	0.825	model1_4xbmB.pdb.gz
5	1yo8A	0.64	3.44	0.168	0.944	model1_1yo8A.pdb.gz
6	4d90A	0.58	2.77	0.277	0.714	model1_4d90A.pdb.gz
7	5fmaA	0.58	2.63	0.196	0.738	model1_5fmaA.pdb.gz
8	4qo6A	0.56	4.42	0.025	0.929	model1_4qo6A.pdb.gz
9	2bo2A	0.51	4.04	0.165	0.865	model1_2bo2A.pdb.gz
10	1n7dA	0.47	3.67	0.154	0.730	model1_1n7dA.pdb.gz

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0005509	0.84	calcium ion binding
GO:0005102	0.79	receptor binding
GO:0005112	0.71	Notch binding
GO:0004872	0.60	receptor activity
GO:0098772	0.58	molecular function regulator
GO:0046983	0.58	protein dimerization activity
GO:0044877	0.58	macromolecular complex binding
GO:0046982	0.57	protein heterodimerization activity
GO:0019899	0.57	enzyme binding
GO:0004857	0.57	enzyme inhibitor activity
GO:0043565	0.56	sequence-specific DNA binding
GO:0003700	0.56	transcription factor activity, sequence-specific DNA binding
GO:0003682	0.56	chromatin binding
GO:0001190	0.56	transcriptional activator activity, RNA polymerase II transcription factor binding
GO:0001047	0.56	core promoter binding
GO:0031490	0.55	chromatin DNA binding
GO:0097367	0.50	carbohydrate derivative binding

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0044699	0.92	single-organism process
GO:0065007	0.89	biological regulation
GO:0050789	0.88	regulation of biological process
GO:0032502	0.88	developmental process
GO:0050794	0.86	regulation of cellular process
GO:0009987	0.85	cellular process
GO:0044767	0.84	single-organism developmental process
GO:0044763	0.84	single-organism cellular process
GO:0048856	0.81	anatomical structure development
GO:0051239	0.78	regulation of multicellular organismal process
GO:0009653	0.78	anatomical structure morphogenesis
GO:2000026	0.77	regulation of multicellular organismal development
GO:0048583	0.77	regulation of response to stimulus
GO:0048523	0.76	negative regulation of cellular process
GO:0045595	0.76	regulation of cell differentiation
GO:0032501	0.76	multicellular organismal process
GO:0060284	0.75	regulation of cell development
GO:0048518	0.75	positive regulation of biological process
GO:0044707	0.75	single-multicellular organism process
GO:0022603	0.75	regulation of anatomical structure morphogenesis
GO:0009966	0.75	regulation of signal transduction
GO:0050767	0.74	regulation of neurogenesis
GO:0048522	0.74	positive regulation of cellular process
GO:0048584	0.73	positive regulation of response to stimulus
GO:0048513	0.73	animal organ development
GO:0045664	0.73	regulation of neuron differentiation
GO:0051241	0.72	negative regulation of multicellular organismal process
GO:0051093	0.72	negative regulation of developmental process
GO:0009967	0.72	positive regulation of signal transduction
GO:0050768	0.71	negative regulation of neurogenesis
GO:0008593	0.71	regulation of Notch signaling pathway
GO:0007389	0.71	pattern specification process
GO:0048598	0.70	embryonic morphogenesis
GO:0045665	0.70	negative regulation of neuron differentiation
GO:0035239	0.70	tube morphogenesis
GO:0009952	0.70	anterior/posterior pattern specification
GO:0007165	0.70	signal transduction
GO:0002009	0.70	morphogenesis of an epithelium
GO:0097150	0.69	neuronal stem cell population maintenance
GO:0060562	0.69	epithelial tube morphogenesis
GO:0051147	0.69	regulation of muscle cell differentiation
GO:0045995	0.69	regulation of embryonic development
GO:0045747	0.69	positive regulation of Notch signaling pathway
GO:0030856	0.69	regulation of epithelial cell differentiation
GO:0007166	0.69	cell surface receptor signaling pathway
GO:0070986	0.68	left/right axis specification
GO:0045662	0.68	negative regulation of myoblast differentiation
GO:0045608	0.68	negative regulation of auditory receptor cell differentiation
GO:0031099	0.68	regeneration
GO:0014807	0.68	regulation of somitogenesis
GO:0007386	0.68	compartment pattern specification
GO:0001947	0.68	heart looping
GO:0048869	0.67	cellular developmental process
GO:0031100	0.67	organ regeneration
GO:0016043	0.67	cellular component organization
GO:0051128	0.66	regulation of cellular component organization
GO:0006928	0.65	movement of cell or subcellular component
GO:0048589	0.63	developmental growth
GO:0010769	0.63	regulation of cell morphogenesis involved in differentiation
GO:0050896	0.62	response to stimulus
GO:0048646	0.62	anatomical structure formation involved in morphogenesis
GO:0040011	0.62	locomotion
GO:0030154	0.62	cell differentiation
GO:0080090	0.61	regulation of primary metabolic process
GO:0060560	0.61	developmental growth involved in morphogenesis
GO:0060255	0.61	regulation of macromolecule metabolic process
GO:0048585	0.61	negative regulation of response to stimulus
GO:0032989	0.61	cellular component morphogenesis
GO:0031323	0.61	regulation of cellular metabolic process
GO:0030030	0.61	cell projection organization
GO:0016477	0.61	cell migration
GO:0051240	0.60	positive regulation of multicellular organismal process
GO:0051094	0.60	positive regulation of developmental process
GO:0010468	0.60	regulation of gene expression
GO:0009968	0.60	negative regulation of signal transduction
GO:0009888	0.60	tissue development
GO:0090287	0.59	regulation of cellular response to growth factor stimulus
GO:0051179	0.59	localization
GO:0051130	0.59	positive regulation of cellular component organization
GO:0048468	0.59	cell development
GO:0045597	0.59	positive regulation of cell differentiation
GO:0042221	0.59	response to chemical
GO:0042127	0.59	regulation of cell proliferation
GO:0040008	0.59	regulation of growth
GO:0032879	0.59	regulation of localization
GO:0009893	0.59	positive regulation of metabolic process
GO:0007409	0.59	axonogenesis
GO:0007219	0.59	Notch signaling pathway
GO:0006355	0.59	regulation of transcription, DNA-templated
GO:0051716	0.58	cellular response to stimulus
GO:0051270	0.58	regulation of cellular component movement
GO:0050790	0.58	regulation of catalytic activity
GO:0048732	0.58	gland development
GO:0048638	0.58	regulation of developmental growth
GO:0044702	0.58	single organism reproductive process
GO:0040012	0.58	regulation of locomotion
GO:0032101	0.58	regulation of response to external stimulus
GO:0031325	0.58	positive regulation of cellular metabolic process
GO:0031324	0.58	negative regulation of cellular metabolic process
GO:0021515	0.58	cell differentiation in spinal cord
GO:0010720	0.58	positive regulation of cell development
GO:0010605	0.58	negative regulation of macromolecule metabolic process
GO:0010604	0.58	positive regulation of macromolecule metabolic process
GO:0010033	0.58	response to organic substance
GO:0008284	0.58	positive regulation of cell proliferation
GO:0008104	0.58	protein localization
GO:0006950	0.58	response to stress
GO:0006810	0.58	transport
GO:0006357	0.58	regulation of transcription from RNA polymerase II promoter
GO:0002376	0.58	immune system process
GO:1902533	0.57	positive regulation of intracellular signal transduction
GO:1901700	0.57	response to oxygen-containing compound
GO:0071310	0.57	cellular response to organic substance
GO:0061314	0.57	Notch signaling involved in heart development
GO:0060627	0.57	regulation of vesicle-mediated transport
GO:0060429	0.57	epithelium development
GO:0051271	0.57	negative regulation of cellular component movement
GO:0050920	0.57	regulation of chemotaxis
GO:0050769	0.57	positive regulation of neurogenesis
GO:0048754	0.57	branching morphogenesis of an epithelial tube
GO:0048663	0.57	neuron fate commitment
GO:0048639	0.57	positive regulation of developmental growth
GO:0048514	0.57	blood vessel morphogenesis
GO:0045893	0.57	positive regulation of transcription, DNA-templated
GO:0045892	0.57	negative regulation of transcription, DNA-templated
GO:0045765	0.57	regulation of angiogenesis
GO:0044765	0.57	single-organism transport
GO:0044087	0.57	regulation of cellular component biogenesis
GO:0043066	0.57	negative regulation of apoptotic process
GO:0040013	0.57	negative regulation of locomotion
GO:0035295	0.57	tube development
GO:0035107	0.57	appendage morphogenesis
GO:0032102	0.57	negative regulation of response to external stimulus
GO:0030855	0.57	epithelial cell differentiation
GO:0030513	0.57	positive regulation of BMP signaling pathway
GO:0030155	0.57	regulation of cell adhesion
GO:0022404	0.57	molting cycle process
GO:0010718	0.57	positive regulation of epithelial to mesenchymal transition
GO:0010594	0.57	regulation of endothelial cell migration
GO:0009792	0.57	embryo development ending in birth or egg hatching
GO:0009719	0.57	response to endogenous stimulus
GO:0009605	0.57	response to external stimulus
GO:0008285	0.57	negative regulation of cell proliferation
GO:0007276	0.57	gamete generation
GO:0003006	0.57	developmental process involved in reproduction
GO:0002682	0.57	regulation of immune system process
GO:0002064	0.57	epithelial cell development
GO:0001889	0.57	liver development
GO:0000904	0.57	cell morphogenesis involved in differentiation
GO:2001027	0.56	negative regulation of endothelial cell chemotaxis
GO:2000974	0.56	negative regulation of pro-B cell differentiation
GO:2000737	0.56	negative regulation of stem cell differentiation
GO:2000179	0.56	positive regulation of neural precursor cell proliferation
GO:1903531	0.56	negative regulation of secretion by cell
GO:1902742	0.56	apoptotic process involved in development
GO:1901652	0.56	response to peptide
GO:0090051	0.56	negative regulation of cell migration involved in sprouting angiogenesis
GO:0072080	0.56	nephron tubule development
GO:0061419	0.56	positive regulation of transcription from RNA polymerase II promoter in response to hypoxia
GO:0060973	0.56	cell migration involved in heart development
GO:0060837	0.56	blood vessel endothelial cell differentiation
GO:0060411	0.56	cardiac septum morphogenesis
GO:0060317	0.56	cardiac epithelial to mesenchymal transition
GO:0060271	0.56	cilium morphogenesis
GO:0060253	0.56	negative regulation of glial cell proliferation
GO:0055006	0.56	cardiac cell development
GO:0055001	0.56	muscle cell development
GO:0051301	0.56	cell division
GO:0050679	0.56	positive regulation of epithelial cell proliferation
GO:0048845	0.56	venous blood vessel morphogenesis
GO:0048844	0.56	artery morphogenesis
GO:0048715	0.56	negative regulation of oligodendrocyte differentiation
GO:0048711	0.56	positive regulation of astrocyte differentiation
GO:0046620	0.56	regulation of organ growth
GO:0046427	0.56	positive regulation of JAK-STAT cascade
GO:0045844	0.56	positive regulation of striated muscle tissue development
GO:0045667	0.56	regulation of osteoblast differentiation
GO:0045603	0.56	positive regulation of endothelial cell differentiation
GO:0043207	0.56	response to external biotic stimulus
GO:0043086	0.56	negative regulation of catalytic activity
GO:0043065	0.56	positive regulation of apoptotic process
GO:0042246	0.56	tissue regeneration
GO:0035148	0.56	tube formation
GO:0032870	0.56	cellular response to hormone stimulus
GO:0031960	0.56	response to corticosteroid
GO:0030514	0.56	negative regulation of BMP signaling pathway
GO:0030326	0.56	embryonic limb morphogenesis
GO:0030178	0.56	negative regulation of Wnt signaling pathway
GO:0014706	0.56	striated muscle tissue development
GO:0010832	0.56	negative regulation of myotube differentiation
GO:0010810	0.56	regulation of cell-substrate adhesion
GO:0009912	0.56	auditory receptor cell fate commitment
GO:0009306	0.56	protein secretion
GO:0007440	0.56	foregut morphogenesis
GO:0007283	0.56	spermatogenesis
GO:0007221	0.56	positive regulation of transcription of Notch receptor target
GO:0007162	0.56	negative regulation of cell adhesion
GO:0006955	0.56	immune response
GO:0006954	0.56	inflammatory response
GO:0003344	0.56	pericardium morphogenesis
GO:0003222	0.56	ventricular trabecula myocardium morphogenesis
GO:0003209	0.56	cardiac atrium morphogenesis
GO:0003208	0.56	cardiac ventricle morphogenesis
GO:0003184	0.56	pulmonary valve morphogenesis
GO:0003160	0.56	endocardium morphogenesis
GO:0002065	0.56	columnar/cuboidal epithelial cell differentiation
GO:0001701	0.56	in utero embryonic development
GO:0001570	0.56	vasculogenesis
GO:0000122	0.56	negative regulation of transcription from RNA polymerase II promoter
GO:2000811	0.55	negative regulation of anoikis
GO:1902263	0.55	apoptotic process involved in embryonic digit morphogenesis
GO:1901201	0.55	regulation of extracellular matrix assembly
GO:0090090	0.55	negative regulation of canonical Wnt signaling pathway
GO:0072602	0.55	interleukin-4 secretion
GO:0072144	0.55	glomerular mesangial cell development
GO:0072044	0.55	collecting duct development
GO:0072017	0.55	distal tubule development
GO:0071372	0.55	cellular response to follicle-stimulating hormone stimulus
GO:0060982	0.55	coronary artery morphogenesis
GO:0060979	0.55	vasculogenesis involved in coronary vascular morphogenesis
GO:0060956	0.55	endocardial cell differentiation
GO:0060948	0.55	cardiac vascular smooth muscle cell development
GO:0060843	0.55	venous endothelial cell differentiation
GO:0060768	0.55	regulation of epithelial cell proliferation involved in prostate gland development
GO:0060740	0.55	prostate gland epithelium morphogenesis
GO:0060528	0.55	secretory columnal luminar epithelial cell differentiation involved in prostate glandular acinus development
GO:0060412	0.55	ventricular septum morphogenesis
GO:0060045	0.55	positive regulation of cardiac muscle cell proliferation
GO:0050434	0.55	positive regulation of viral transcription
GO:0048103	0.55	somatic stem cell division
GO:0046533	0.55	negative regulation of photoreceptor cell differentiation
GO:0045955	0.55	negative regulation of calcium ion-dependent exocytosis
GO:0045668	0.55	negative regulation of osteoblast differentiation
GO:0045618	0.55	positive regulation of keratinocyte differentiation
GO:0045070	0.55	positive regulation of viral genome replication
GO:0035914	0.55	skeletal muscle cell differentiation
GO:0035116	0.55	embryonic hindlimb morphogenesis
GO:0032496	0.55	response to lipopolysaccharide
GO:0032495	0.55	response to muramyl dipeptide
GO:0031069	0.55	hair follicle morphogenesis
GO:0030900	0.55	forebrain development
GO:0030324	0.55	lung development
GO:0021915	0.55	neural tube development
GO:0010812	0.55	negative regulation of cell-substrate adhesion
GO:0007492	0.55	endoderm development
GO:0006959	0.55	humoral immune response
GO:0003273	0.55	cell migration involved in endocardial cushion formation
GO:0003270	0.55	Notch signaling pathway involved in regulation of secondary heart field cardioblast proliferation
GO:0003256	0.55	regulation of transcription from RNA polymerase II promoter involved in myocardial precursor cell differentiation
GO:0003241	0.55	growth involved in heart morphogenesis
GO:0003219	0.55	cardiac right ventricle formation
GO:0003214	0.55	cardiac left ventricle morphogenesis
GO:0003213	0.55	cardiac right atrium morphogenesis
GO:0003198	0.55	epithelial to mesenchymal transition involved in endocardial cushion formation
GO:0003192	0.55	mitral valve formation
GO:0003180	0.55	aortic valve morphogenesis
GO:0003169	0.55	coronary vein morphogenesis
GO:0003162	0.55	atrioventricular node development
GO:0002437	0.55	inflammatory response to antigenic stimulus
GO:0002052	0.55	positive regulation of neuroblast proliferation

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0044464	0.86	cell part
GO:0043226	0.72	organelle
GO:0044421	0.71	extracellular region part
GO:0016020	0.66	membrane
GO:0043227	0.62	membrane-bounded organelle
GO:0005886	0.60	plasma membrane
GO:0031982	0.58	vesicle
GO:0005576	0.57	extracellular region
GO:0044425	0.56	membrane part
GO:0031012	0.51	extracellular matrix
GO:0016021	0.51	integral component of membrane
GO:0031988	0.50	membrane-bounded vesicle

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted Enzyme Commission (EC) Numbers

Top 5 enzyme homologs in PDB

Rank	Cscore^EC	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	EC Number	Predicted Active Site Residues
1	0.060	2du3A	0.440	5.14	0.046	0.809	6.1.1.27	NA
2	0.060	2np0A	0.365	4.94	0.020	0.698	3.4.24.69	NA
3	0.060	2zy2A	0.403	4.19	0.088	0.675	4.1.1.12	NA
4	0.060	3ixzA	0.403	5.24	0.032	0.754	3.6.3.10	NA
5	0.060	1igrA	0.436	4.50	0.034	0.770	2.7.10.1	29

	Click on the radio buttons to visualize predicted active site residues.
(a)	Cscore^EC is the confidence score for the Enzyme Commission (EC) number prediction. Cscore^EC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Ligand Binding Sites

Template proteins with similar binding site:

Rank	Cscore^LB	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	BS-score	Lig. Name	Download Complex	Predicted binding site residues
1	0.10	1w0yL	0.479	3.68	0.192	0.714	1.61	FUC	complex1.pdb.gz	55,57,69,70,71
2	0.08	1dvaL	0.351	2.17	0.174	0.405	1.59	FUC	complex2.pdb.gz	96,97,98,109,110
3	0.03	1dvaL	0.351	2.17	0.174	0.405	1.31	UUU	complex3.pdb.gz	87,90,104,105,106,117
4	0.01	2lgpA	0.218	4.24	0.071	0.349	0.89	CA	complex4.pdb.gz	54,56,71,79,80

	Click on the radio buttons to visualize predicted binding site and residues.
(a)	Cscore^LB is the confidence score of predicted binding site. Cscore^LB values range in between [0-1]; where a higher score indicates a more reliable ligand-binding site prediction.
(b)	BS-score is a measure of local similarity (sequence & structure) between template binding site and predicted binding site in the query structure. Based on large scale benchmarking analysis, we have observed that a BS-score >1 reflects a significant local match between the predicted and template binding site.
(c)	TM-score is a measure of global structural similarity between query and template protein.
(d)	RMSD^a the RMSD between residues that are structurally aligned by TM-align.
(e)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(f)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

[Click result.zip to download all results on this page]

References:
1.	Wei Zheng, Qiqige Wuyun, Yang Li, Quancheng Liu, Xiaogen Zhou, Yiheng Zhu, P. Lydia Freddolino, Yang Zhang. Integrating deep learning potentials with I-TASSER for single- and multi-domain protein structure prediction. Submitted. 2023.