D-I-TASSER Q6UXF7

D-I-TASSER results for Q6UXF7

[Click result.zip to download all results on this page]

Summary of the Protein

Uniprot ID: Q6UXF7
Protein Name: C-type lectin domain family 18 member B
Gene Name: CLEC18B

Input Sequence in FASTA format

>Q6UXF7 (455 residues)
MLHPETSPGRGHLLAVLLALLGTTWAEVWPPQLQEQAPMAGALNRKESFLLLSLHNRLRS
WVQPPAADMRRLDWSDSLAQLAQARAALCGIPTPSLASGLWRTLQVGWNMQLLPAGLASF
VEVVSLWFAEGQRYSHAAGECARNATCTHYTQLVWATSSQLGCGRHLCSAGQTAIEAFVC
AYSPGGNWEVNGKTIIPYKKGAWCSLCTASVSGCFKAWDHAGGLCEVPRNPCRMSCQNHG
RLNISTCHCHCPPGYTGRYCQVRCSLQCVHGRFREEECSCVCDIGYGGAQCATKVHFPFH
TCDLRIDGDCFMVSSEADTYYRARMKCQRKGGVLAQIKSQKVQDILAFYLGRLETTNEVI
DSDFETRNFWIGLTYKTAKDSFRWATGEHQAFTSFAFGQPDNHGLVWLSAAMGFGNCVEL
QASAAFNWNDQRCKTRNRYICQFAQEHISRWGPGS

Predicted Contact and Distance Map Used in D-I-TASSER simulation

Contact Map

Distance Map

D-I-TASSER simulation is guided by the consensus contact map (left figure) and distance map (right figure) derived based on confidence scores of DeepPotential. In the contact, distance map and hydrogen bond networks, the axes mark the residue index along the sequence. For the contact map, each dot represents a residue pair with predicted contact, while for the distance map and hydrogen bond network, a color scale represents a distance of 1-20+ angstroms or a angle of 0-180 degree.

Information of Domain

No. of Domain	Domain	Domain Boundary	Length of Domain	Models of Domain	Sequence
1	Q6UXF7-D1	1-226	226		MLHPETSPGRGHLLAVLLALLGTTWAEVWPPQLQEQAPMAGALNRKESFLLLSLHNRLRSWVQPPAADMRRLDWSDSLAQLAQARAALCGIPTPSLASGLWRTLQVGWNMQLLPAGLASFVEVVSLWFAEGQRYSHAAGECARNATCTHYTQLVWATSSQLGCGRHLCSAGQTAIEAFVCAYSPGGNWEVNGKTIIPYKKGAWCSLCTASVSGCFKAWDHAGGLCE
2	Q6UXF7-D2	227-295	69		VPRNPCRMSCQNHGRLNISTCHCHCPPGYTGRYCQVRCSLQCVHGRFREEECSCVCDIGYGGAQCATKV
3	Q6UXF7-D3	296-368	73		HFPFHTCDLRIDGDCFMVSSEADTYYRARMKCQRKGGVLAQIKSQKVQDILAFYLGRLETTNEVIDSDFETRN
4	Q6UXF7-D4	369-455	87		FWIGLTYKTAKDSFRWATGEHQAFTSFAFGQPDNHGLVWLSAAMGFGNCVELQASAAFNWNDQRCKTRNRYICQFAQEHISRWGPGS

Top 1 final models from D-I-TASSER

Click to view	Rank^a	Download	Estimated TM-score^b
	1	model1.pdb.gz	0.43

(a)

D-I-TASSER simulations generate a large ensemble of structural conformations, i.e. decoys. These decoys are clustered by SPICKER based on pairwise structure similarity to report up to five final models from the five largest clusters. Models are ranked in descending order of cluster size. If the simulations converge well, it is possible to have less than 5 models generated, which is usually an indication of good model quality.

(b)

The model confidence is quantitatified by estimated TM-score (eTM-score), calculated based on significance of threading template alignments, contact map satisfaction rate, mean absolute error between distance of model and distance of DeepPotential, and convergence of D-I-TASSER simulations. eTM-score is typically in the range of [0, 1], with higher eTM-score signifies higher model confidence.

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	3nt8A	0.40	3.64	0.213	0.448	model1_3nt8A.pdb.gz
2	1xtaA	0.38	2.93	0.226	0.415	model1_1xtaA.pdb.gz
3	3q2rA	0.37	2.24	0.322	0.391	model1_3q2rA.pdb.gz
4	3u3lC	0.36	2.58	0.156	0.396	model1_3u3lC.pdb.gz
5	2ddbB	0.36	2.56	0.240	0.382	model1_2ddbB.pdb.gz
6	1u53A	0.35	2.05	0.272	0.369	model1_1u53A.pdb.gz
7	4tpvA	0.34	2.52	0.209	0.367	model1_4tpvA.pdb.gz
8	2vznA	0.34	2.54	0.224	0.363	model1_2vznA.pdb.gz
9	1qnxA	0.33	1.99	0.246	0.347	model1_1qnxA.pdb.gz
10	1smbA	0.29	2.61	0.217	0.314	model1_1smbA.pdb.gz

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0097367	0.62	carbohydrate derivative binding
GO:0005539	0.55	glycosaminoglycan binding

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0032502	0.78	developmental process
GO:0048856	0.68	anatomical structure development
GO:0065007	0.62	biological regulation
GO:0048731	0.60	system development
GO:0044699	0.60	single-organism process
GO:0007155	0.60	cell adhesion
GO:0009987	0.58	cellular process
GO:0007417	0.58	central nervous system development
GO:0001501	0.57	skeletal system development

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0044464	0.91	cell part
GO:0044424	0.79	intracellular part
GO:0044421	0.63	extracellular region part
GO:0043226	0.55	organelle
GO:0043227	0.54	membrane-bounded organelle

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted Enzyme Commission (EC) Numbers

Top 5 enzyme homologs in PDB

Rank	Cscore^EC	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	EC Number	Predicted Active Site Residues
1	0.060	2zzgA	0.322	7.41	0.069	0.541	6.1.1.7	NA
2	0.060	2vz9B	0.322	7.34	0.050	0.536	2.3.1.85	NA
3	0.060	2fgeA	0.318	7.40	0.034	0.541	3.4.24.-	NA
4	0.060	3ffzA	0.306	7.48	0.027	0.521	3.4.24.69	NA
5	0.060	2jfdA	0.234	7.57	0.044	0.402	2.3.1.85	NA

	Click on the radio buttons to visualize predicted active site residues.
(a)	Cscore^EC is the confidence score for the Enzyme Commission (EC) number prediction. Cscore^EC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Ligand Binding Sites

Template proteins with similar binding site:

Rank	Cscore^LB	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	BS-score	Lig. Name	Download Complex	Predicted binding site residues
1	0.02	1ofdB	0.328	7.36	0.040	0.549	0.31	F3S	complex1.pdb.gz	108,109,110,111,127
2	0.01	1jdbE	0.335	7.48	0.036	0.567	0.35	GLN	complex2.pdb.gz	107,155,158
3	0.01	1llzA	0.319	7.54	0.036	0.541	0.22	F3S	complex3.pdb.gz	160,161,162,180
4	0.01	3b2pA	0.328	7.05	0.044	0.536	0.15	ARG	complex4.pdb.gz	78,150,186
5	0.01	1ea0B	0.325	7.66	0.038	0.565	0.19	OMT	complex5.pdb.gz	110,152,162,185
6	0.01	1ofdA	0.322	7.37	0.031	0.538	0.13	FMN	complex6.pdb.gz	76,162,163
7	0.01	1m6vC	0.349	7.33	0.037	0.585	0.16	ADP	complex7.pdb.gz	107,124,125,126,128,150,151,152,361
8	0.01	1a9x0	0.326	7.68	0.047	0.565	0.20	III	complex8.pdb.gz	128,153,163,185
9	0.01	1ce8E	0.320	7.37	0.036	0.530	0.21	ADP	complex9.pdb.gz	55,73,74,75
10	0.01	1bxrA	0.327	7.46	0.053	0.552	0.11	ANP	complex10.pdb.gz	78,79,159,180

	Click on the radio buttons to visualize predicted binding site and residues.
(a)	Cscore^LB is the confidence score of predicted binding site. Cscore^LB values range in between [0-1]; where a higher score indicates a more reliable ligand-binding site prediction.
(b)	BS-score is a measure of local similarity (sequence & structure) between template binding site and predicted binding site in the query structure. Based on large scale benchmarking analysis, we have observed that a BS-score >1 reflects a significant local match between the predicted and template binding site.
(c)	TM-score is a measure of global structural similarity between query and template protein.
(d)	RMSD^a the RMSD between residues that are structurally aligned by TM-align.
(e)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(f)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

[Click result.zip to download all results on this page]

References:
1.	Wei Zheng, Qiqige Wuyun, Yang Li, Quancheng Liu, Xiaogen Zhou, Yiheng Zhu, P. Lydia Freddolino, Yang Zhang. Integrating deep learning potentials with I-TASSER for single- and multi-domain protein structure prediction. Submitted. 2023.