D-I-TASSER Q717R9

D-I-TASSER results for Q717R9

[Click result.zip to download all results on this page]

Summary of the Protein

Uniprot ID: Q717R9
Protein Name: Cystin-1
Gene Name: CYS1

Input Sequence in FASTA format

>Q717R9 (158 residues)
MGSGSSRSSRTLRRRRSPESLPAGPGAAALEGGTRRRVPVAAAEVPGAAAEEAPGRDPSP
VAPPDGRDETLRLLDELLAESAAWGPPEPAPRRPARLRPTAVAGSAVCAEQSTEGHPGSG
NVSEAPGSGRKKPERPAAISYDHSEEGLMASIEREYCR

Predicted Contact and Distance Map Used in D-I-TASSER simulation

Contact Map

Distance Map

D-I-TASSER simulation is guided by the consensus contact map (left figure) and distance map (right figure) derived based on confidence scores of DeepPotential. In the contact, distance map and hydrogen bond networks, the axes mark the residue index along the sequence. For the contact map, each dot represents a residue pair with predicted contact, while for the distance map and hydrogen bond network, a color scale represents a distance of 1-20+ angstroms or a angle of 0-180 degree.

Information of Domain

No. of Domain	Domain	Domain Boundary	Length of Domain	Models of Domain	Sequence
1	Q717R9-D1	1-158	158		MGSGSSRSSRTLRRRRSPESLPAGPGAAALEGGTRRRVPVAAAEVPGAAAEEAPGRDPSPVAPPDGRDETLRLLDELLAESAAWGPPEPAPRRPARLRPTAVAGSAVCAEQSTEGHPGSGNVSEAPGSGRKKPERPAAISYDHSEEGLMASIEREYCR

Top 1 final models from D-I-TASSER

Click to view	Rank^a	Download	Estimated TM-score^b
	1	model1.pdb.gz	0.4944

(a)

D-I-TASSER simulations generate a large ensemble of structural conformations, i.e. decoys. These decoys are clustered by SPICKER based on pairwise structure similarity to report up to five final models from the five largest clusters. Models are ranked in descending order of cluster size. If the simulations converge well, it is possible to have less than 5 models generated, which is usually an indication of good model quality.

(b)

The model confidence is quantitatified by estimated TM-score (eTM-score), calculated based on significance of threading template alignments, contact map satisfaction rate, mean absolute error between distance of model and distance of DeepPotential, and convergence of D-I-TASSER simulations. eTM-score is typically in the range of [0, 1], with higher eTM-score signifies higher model confidence.

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	3qmzA	0.46	5.77	0.053	0.905	model1_3qmzA.pdb.gz
2	3ttoA3	0.45	5.02	0.061	0.778	model1_3ttoA3.pdb.gz
3	4he8L	0.45	5.09	0.067	0.785	model1_4he8L.pdb.gz
4	2vtfA1	0.45	4.90	0.047	0.759	model1_2vtfA1.pdb.gz
5	3hz3A3	0.42	5.43	0.066	0.797	model1_3hz3A3.pdb.gz
6	2w92A1	0.40	4.91	0.046	0.677	model1_2w92A1.pdb.gz
7	3bh4A	0.37	5.27	0.022	0.652	model1_3bh4A.pdb.gz
8	1eg7A2	0.36	5.75	0.015	0.690	model1_1eg7A2.pdb.gz
9	1xwiA	0.34	5.43	0.021	0.633	model1_1xwiA.pdb.gz
10	3a2kA1	0.34	5.63	0.063	0.639	model1_3a2kA1.pdb.gz

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:1901363	0.42	heterocyclic compound binding
GO:0097159	0.42	organic cyclic compound binding
GO:0003700	0.41	transcription factor activity, sequence-specific DNA binding
GO:0044877	0.40	macromolecular complex binding
GO:0000981	0.40	RNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0003682	0.38	chromatin binding
GO:0000977	0.38	RNA polymerase II regulatory region sequence-specific DNA binding
GO:0001191	0.37	transcriptional repressor activity, RNA polymerase II transcription factor binding
GO:0001077	0.37	transcriptional activator activity, RNA polymerase II core promoter proximal region sequence-specific binding
GO:0000978	0.37	RNA polymerase II core promoter proximal region sequence-specific DNA binding
GO:0043167	0.31	ion binding
GO:0043169	0.30	cation binding

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0044699	0.90	single-organism process
GO:0065007	0.89	biological regulation
GO:0050789	0.86	regulation of biological process
GO:0050794	0.85	regulation of cellular process
GO:0032502	0.72	developmental process
GO:0048518	0.71	positive regulation of biological process
GO:0044767	0.71	single-organism developmental process
GO:0048519	0.70	negative regulation of biological process
GO:0048856	0.68	anatomical structure development
GO:0048522	0.68	positive regulation of cellular process
GO:0031323	0.68	regulation of cellular metabolic process
GO:0080090	0.67	regulation of primary metabolic process
GO:0060255	0.66	regulation of macromolecule metabolic process
GO:0065009	0.64	regulation of molecular function
GO:0031326	0.64	regulation of cellular biosynthetic process
GO:0019219	0.64	regulation of nucleobase-containing compound metabolic process
GO:0048513	0.63	animal organ development
GO:0031325	0.63	positive regulation of cellular metabolic process
GO:0006355	0.63	regulation of transcription, DNA-templated
GO:0010604	0.62	positive regulation of macromolecule metabolic process
GO:0045893	0.61	positive regulation of transcription, DNA-templated
GO:0044092	0.61	negative regulation of molecular function
GO:0006357	0.61	regulation of transcription from RNA polymerase II promoter
GO:0045944	0.60	positive regulation of transcription from RNA polymerase II promoter
GO:0048839	0.59	inner ear development
GO:0043433	0.59	negative regulation of sequence-specific DNA binding transcription factor activity
GO:0001822	0.59	kidney development
GO:0009987	0.55	cellular process

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0070062	1.00	extracellular exosome
GO:0005829	1.00	cytosol
GO:0072372	0.63	primary cilium
GO:0044422	0.50	organelle part

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted Enzyme Commission (EC) Numbers

Top 5 enzyme homologs in PDB

Rank	Cscore^EC	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	EC Number	Predicted Active Site Residues
1	0.060	1siqA	0.430	5.05	0.053	0.747	1.3.99.7	153
2	0.060	1l1lA	0.431	5.32	0.045	0.797	1.17.4.2	NA
3	0.060	2j5nB	0.438	5.64	0.059	0.817	1.5.1.12	NA
4	0.060	1j93A	0.432	4.47	0.083	0.683	4.1.1.37	NA
5	0.060	1cygA	0.432	5.09	0.060	0.766	2.4.1.19	31

	Click on the radio buttons to visualize predicted active site residues.
(a)	Cscore^EC is the confidence score for the Enzyme Commission (EC) number prediction. Cscore^EC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Ligand Binding Sites

Template proteins with similar binding site:

Rank	Cscore^LB	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	BS-score	Lig. Name	Download Complex	Predicted binding site residues
1	0.01	1llaA	0.448	5.49	0.076	0.823	0.69	NA	complex1.pdb.gz	106,108,112,137
2	0.01	1o05B	0.419	5.31	0.048	0.766	0.51	NA	complex2.pdb.gz	105,120,137
3	0.01	1h18B	0.437	5.54	0.047	0.791	0.54	DTL	complex3.pdb.gz	34,35,63,67

	Click on the radio buttons to visualize predicted binding site and residues.
(a)	Cscore^LB is the confidence score of predicted binding site. Cscore^LB values range in between [0-1]; where a higher score indicates a more reliable ligand-binding site prediction.
(b)	BS-score is a measure of local similarity (sequence & structure) between template binding site and predicted binding site in the query structure. Based on large scale benchmarking analysis, we have observed that a BS-score >1 reflects a significant local match between the predicted and template binding site.
(c)	TM-score is a measure of global structural similarity between query and template protein.
(d)	RMSD^a the RMSD between residues that are structurally aligned by TM-align.
(e)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(f)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

[Click result.zip to download all results on this page]

References:
1.	Wei Zheng, Qiqige Wuyun, Yang Li, Quancheng Liu, Xiaogen Zhou, Yiheng Zhu, P. Lydia Freddolino, Yang Zhang. Integrating deep learning potentials with I-TASSER for single- and multi-domain protein structure prediction. Submitted. 2023.