D-I-TASSER Q86YQ2

D-I-TASSER results for Q86YQ2

[Click result.zip to download all results on this page]

Summary of the Protein

Uniprot ID: Q86YQ2
Protein Name: Putative BPIFA4P protein
Gene Name: BPIFA4P

Input Sequence in FASTA format

>Q86YQ2 (179 residues)
MLNVSGLFVLLCGLLVSSSAQEVLAGVSSQLLNDLTQGLLRADFLPSLQTTGLQKPLSSA
FDGVSGLLDIFGPPLTNEINTVSIQVKNPQLLHVSIESTPQRKEATVQVPFTSELIVQLL
TMKPFTANMQSDIKVQIRLEKNVGGRYELAFGNCRLLPEAIWIQTGVQLAPAQNLLWQT

Predicted Contact and Distance Map Used in D-I-TASSER simulation

Contact Map

Distance Map

D-I-TASSER simulation is guided by the consensus contact map (left figure) and distance map (right figure) derived based on confidence scores of DeepPotential. In the contact, distance map and hydrogen bond networks, the axes mark the residue index along the sequence. For the contact map, each dot represents a residue pair with predicted contact, while for the distance map and hydrogen bond network, a color scale represents a distance of 1-20+ angstroms or a angle of 0-180 degree.

Information of Domain

No. of Domain	Domain	Domain Boundary	Length of Domain	Models of Domain	Sequence
1	Q86YQ2-D1	1-179	179		MLNVSGLFVLLCGLLVSSSAQEVLAGVSSQLLNDLTQGLLRADFLPSLQTTGLQKPLSSAFDGVSGLLDIFGPPLTNEINTVSIQVKNPQLLHVSIESTPQRKEATVQVPFTSELIVQLLTMKPFTANMQSDIKVQIRLEKNVGGRYELAFGNCRLLPEAIWIQTGVQLAPAQNLLWQT

Top 1 final models from D-I-TASSER

Click to view	Rank^a	Download	Estimated TM-score^b
	1	model1.pdb.gz	0.69

(a)

D-I-TASSER simulations generate a large ensemble of structural conformations, i.e. decoys. These decoys are clustered by SPICKER based on pairwise structure similarity to report up to five final models from the five largest clusters. Models are ranked in descending order of cluster size. If the simulations converge well, it is possible to have less than 5 models generated, which is usually an indication of good model quality.

(b)

The model confidence is quantitatified by estimated TM-score (eTM-score), calculated based on significance of threading template alignments, contact map satisfaction rate, mean absolute error between distance of model and distance of DeepPotential, and convergence of D-I-TASSER simulations. eTM-score is typically in the range of [0, 1], with higher eTM-score signifies higher model confidence.

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	3zpmA	0.61	3.90	0.270	0.832	model1_3zpmA.pdb.gz
2	4kghB	0.54	3.90	0.228	0.737	model1_4kghB.pdb.gz
3	3a1zA	0.53	4.21	0.081	0.788	model1_3a1zA.pdb.gz
4	3e8wA	0.52	4.27	0.075	0.782	model1_3e8wA.pdb.gz
5	4p42A1	0.52	4.24	0.107	0.782	model1_4p42A1.pdb.gz
6	6ekvA	0.52	4.32	0.071	0.782	model1_6ekvA.pdb.gz
7	4m4dA1	0.51	4.44	0.109	0.754	model1_4m4dA1.pdb.gz
8	2rckA	0.50	4.38	0.079	0.771	model1_2rckA.pdb.gz
9	1bp1A1	0.50	4.20	0.107	0.721	model1_1bp1A1.pdb.gz
10	2nq3A	0.33	4.51	0.063	0.520	model1_2nq3A.pdb.gz

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0070011	0.94	peptidase activity, acting on L-amino acid peptides
GO:0004252	0.60	serine-type endopeptidase activity
GO:0008289	0.59	lipid binding

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0065007	1.00	biological regulation
GO:0044699	0.96	single-organism process
GO:0009987	0.94	cellular process
GO:0048871	0.92	multicellular organismal homeostasis
GO:0050828	0.91	regulation of liquid surface tension
GO:0001659	0.54	temperature homeostasis
GO:0007049	0.50	cell cycle

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0044464	0.90	cell part
GO:0044424	0.86	intracellular part
GO:0043227	0.84	membrane-bounded organelle
GO:0043231	0.78	intracellular membrane-bounded organelle
GO:0044421	0.76	extracellular region part
GO:0016020	0.69	membrane
GO:0044425	0.66	membrane part
GO:0005576	0.64	extracellular region
GO:0044444	0.63	cytoplasmic part
GO:0044446	0.62	intracellular organelle part
GO:0005886	0.55	plasma membrane
GO:0016021	0.54	integral component of membrane
GO:0031988	0.52	membrane-bounded vesicle

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted Enzyme Commission (EC) Numbers

Top 5 enzyme homologs in PDB

Rank	Cscore^EC	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	EC Number	Predicted Active Site Residues
1	0.060	2jkpB	0.404	4.00	0.056	0.564	3.2.1.20	NA
2	0.060	1j2gC	0.414	4.61	0.041	0.642	1.7.3.3	37
3	0.060	1z45A	0.463	4.90	0.043	0.737	5.1.3.2 5.1.3.3	112,134
4	0.060	3errA	0.432	5.21	0.047	0.732	6.1.1.11	NA
5	0.060	1serB	0.330	5.04	0.058	0.536	6.1.1.11	NA

	Click on the radio buttons to visualize predicted active site residues.
(a)	Cscore^EC is the confidence score for the Enzyme Commission (EC) number prediction. Cscore^EC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Ligand Binding Sites

Template proteins with similar binding site:

Rank	Cscore^LB	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	BS-score	Lig. Name	Download Complex	Predicted binding site residues
1	0.01	2c3eA	0.443	5.11	0.060	0.754	0.14	CDL	complex1.pdb.gz	41,42,44,47,51,52
2	0.01	1w0oA	0.457	5.41	0.057	0.788	0.15	SIA	complex2.pdb.gz	39,45,48
3	0.01	2obdA	0.474	4.94	0.086	0.771	0.14	2OB	complex3.pdb.gz	107,133,135
4	0.01	2c3eA	0.443	5.11	0.060	0.754	0.19	CXT	complex4.pdb.gz	38,41,42,148
5	0.01	3e8tA	0.525	4.24	0.089	0.793	0.18	UQ8	complex5.pdb.gz	91,131,162
6	0.01	3e8wA	0.524	4.27	0.075	0.782	0.18	UQ8	complex6.pdb.gz	131,133,135,161
7	0.01	3fs30	0.448	4.68	0.060	0.698	0.25	III	complex7.pdb.gz	7,8,10,11,13,14,15,17,18,20,21,24,25,28,29,31,32,35,36,39,40,42
8	0.01	2obdA	0.474	4.94	0.086	0.771	0.25	PCW	complex8.pdb.gz	35,39,44,45,53,85,91,111,113,115
9	0.01	1w0pA	0.458	5.34	0.057	0.788	0.21	SIA	complex9.pdb.gz	90,92,107
10	0.01	1z450	0.463	4.90	0.043	0.737	0.14	III	complex10.pdb.gz	49,52,53,55,59,62,116

	Click on the radio buttons to visualize predicted binding site and residues.
(a)	Cscore^LB is the confidence score of predicted binding site. Cscore^LB values range in between [0-1]; where a higher score indicates a more reliable ligand-binding site prediction.
(b)	BS-score is a measure of local similarity (sequence & structure) between template binding site and predicted binding site in the query structure. Based on large scale benchmarking analysis, we have observed that a BS-score >1 reflects a significant local match between the predicted and template binding site.
(c)	TM-score is a measure of global structural similarity between query and template protein.
(d)	RMSD^a the RMSD between residues that are structurally aligned by TM-align.
(e)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(f)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

[Click result.zip to download all results on this page]

References:
1.	Wei Zheng, Qiqige Wuyun, Yang Li, Quancheng Liu, Xiaogen Zhou, Yiheng Zhu, P. Lydia Freddolino, Yang Zhang. Integrating deep learning potentials with I-TASSER for single- and multi-domain protein structure prediction. Submitted. 2023.