D-I-TASSER Q9H1N7

D-I-TASSER results for Q9H1N7

[Click result.zip to download all results on this page]

Summary of the Protein

Uniprot ID: Q9H1N7
Protein Name: Adenosine 3'-phospho 5'-phosphosulfate transporter 2
Gene Name: SLC35B3

Input Sequence in FASTA format

>Q9H1N7 (401 residues)
MDLTQQAKDIQNITVQETNKNNSESIECSKITMDLKFNNSRKYISITVPSKTQTMSPHIK
SVDDVVVLGMNLSKFNKLTQFFICVAGVFVFYLIYGYLQELIFSVEGFKSCGWYLTLVQF
AFYSIFGLIELQLIQDKRRRIPGKTYMIIAFLTVGTMGLSNTSLGYLNYPTQVIFKCCKL
IPVMLGGVFIQGKRYNVADVSAAICMSLGLIWFTLADSTTAPNFNLTGVVLISLALCADA
VIGNVQEKAMKLHNASNSEMVLYSYSIGFVYILLGLTCTSGLGPAVTFCAKNPVRTYGYA
FLFSLTGYFGISFVLALIKIFGALIAVTVTTGRKAMTIVLSFIFFAKPFTFQYVWSGLLV
VLGIFLNVYSKNMDKIRLPSLYDLINKSVEARKSRTLAQTV

Predicted Contact and Distance Map Used in D-I-TASSER simulation

Contact Map

Distance Map

D-I-TASSER simulation is guided by the consensus contact map (left figure) and distance map (right figure) derived based on confidence scores of DeepPotential. In the contact, distance map and hydrogen bond networks, the axes mark the residue index along the sequence. For the contact map, each dot represents a residue pair with predicted contact, while for the distance map and hydrogen bond network, a color scale represents a distance of 1-20+ angstroms or a angle of 0-180 degree.

Information of Domain

No. of Domain	Domain	Domain Boundary	Length of Domain	Models of Domain	Sequence
1	Q9H1N7-D1	1-401	401		MDLTQQAKDIQNITVQETNKNNSESIECSKITMDLKFNNSRKYISITVPSKTQTMSPHIKSVDDVVVLGMNLSKFNKLTQFFICVAGVFVFYLIYGYLQELIFSVEGFKSCGWYLTLVQFAFYSIFGLIELQLIQDKRRRIPGKTYMIIAFLTVGTMGLSNTSLGYLNYPTQVIFKCCKLIPVMLGGVFIQGKRYNVADVSAAICMSLGLIWFTLADSTTAPNFNLTGVVLISLALCADAVIGNVQEKAMKLHNASNSEMVLYSYSIGFVYILLGLTCTSGLGPAVTFCAKNPVRTYGYAFLFSLTGYFGISFVLALIKIFGALIAVTVTTGRKAMTIVLSFIFFAKPFTFQYVWSGLLVVLGIFLNVYSKNMDKIRLPSLYDLINKSVEARKSRTLAQTV

Top 1 final models from D-I-TASSER

Click to view	Rank^a	Download	Estimated TM-score^b
	1	model1.pdb.gz	0.7086

(a)

D-I-TASSER simulations generate a large ensemble of structural conformations, i.e. decoys. These decoys are clustered by SPICKER based on pairwise structure similarity to report up to five final models from the five largest clusters. Models are ranked in descending order of cluster size. If the simulations converge well, it is possible to have less than 5 models generated, which is usually an indication of good model quality.

(b)

The model confidence is quantitatified by estimated TM-score (eTM-score), calculated based on significance of threading template alignments, contact map satisfaction rate, mean absolute error between distance of model and distance of DeepPotential, and convergence of D-I-TASSER simulations. eTM-score is typically in the range of [0, 1], with higher eTM-score signifies higher model confidence.

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	6ukjA	0.69	2.76	0.097	0.763	model1_6ukjA.pdb.gz
2	5y78A	0.66	2.71	0.118	0.736	model1_5y78A.pdb.gz
3	5ogeA	0.64	3.19	0.178	0.733	model1_5ogeA.pdb.gz
4	5i20A	0.60	3.28	0.096	0.701	model1_5i20A.pdb.gz
5	6i1rA	0.60	3.64	0.156	0.711	model1_6i1rA.pdb.gz
6	6oh2A	0.59	3.39	0.116	0.681	model1_6oh2A.pdb.gz
7	3dy5A	0.41	5.92	0.050	0.596	model1_3dy5A.pdb.gz
8	1no3A	0.40	6.50	0.022	0.628	model1_1no3A.pdb.gz
9	6gs1A	0.40	5.73	0.043	0.564	model1_6gs1A.pdb.gz
10	4lepA	0.40	5.35	0.036	0.549	model1_4lepA.pdb.gz

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:1901505	1.00	carbohydrate derivative transporter activity
GO:0015932	1.00	nucleobase-containing compound transmembrane transporter activity
GO:1901682	0.67	sulfur compound transmembrane transporter activity
GO:0046964	0.66	3'-phosphoadenosine 5'-phosphosulfate transmembrane transporter activity

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0044699	0.99	single-organism process
GO:0006810	0.94	transport
GO:0044765	0.92	single-organism transport
GO:0071702	0.91	organic substance transport
GO:1901264	0.90	carbohydrate derivative transport
GO:0015931	0.90	nucleobase-containing compound transport
GO:0055085	0.80	transmembrane transport
GO:0015780	0.78	nucleotide-sugar transport
GO:0015781	0.77	pyrimidine nucleotide-sugar transport
GO:0090481	0.75	pyrimidine nucleotide-sugar transmembrane transport
GO:0008643	0.59	carbohydrate transport
GO:0072334	0.58	UDP-galactose transmembrane transport
GO:0008152	0.57	metabolic process
GO:0071704	0.51	organic substance metabolic process

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0044444	1.00	cytoplasmic part
GO:0044431	0.99	Golgi apparatus part
GO:0044425	0.99	membrane part
GO:0030176	0.98	integral component of endoplasmic reticulum membrane
GO:0030173	0.98	integral component of Golgi membrane
GO:0016020	0.57	membrane

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted Enzyme Commission (EC) Numbers

Top 5 enzyme homologs in PDB

Rank	Cscore^EC	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	EC Number	Predicted Active Site Residues
1	0.060	1h0hA	0.359	7.15	0.029	0.626	1.2.1.2	NA
2	0.060	1ti6A	0.345	7.57	0.028	0.623	1.97.1.2	328
3	0.060	1s4bP	0.358	7.03	0.041	0.601	3.4.24.15	NA
4	0.060	1uwyA	0.363	6.51	0.049	0.574	3.4.17.12	NA
5	0.060	2b3xA	0.336	7.15	0.018	0.571	4.2.1.3	NA

	Click on the radio buttons to visualize predicted active site residues.
(a)	Cscore^EC is the confidence score for the Enzyme Commission (EC) number prediction. Cscore^EC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Ligand Binding Sites

Template proteins with similar binding site:

Rank	Cscore^LB	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	BS-score	Lig. Name	Download Complex	Predicted binding site residues
1	0.08	2xydA	0.298	7.42	0.083	0.524	0.16	3ES	complex1.pdb.gz	154,157,158,301,305,308
2	0.07	3dy5A	0.406	5.92	0.050	0.596	0.22	HEM	complex2.pdb.gz	89,161,307,310,311,314,315
3	0.06	3nxqA	0.301	7.31	0.084	0.524	0.12	RX4	complex3.pdb.gz	265,300,301,306
4	0.06	1o8aA	0.374	6.89	0.056	0.614	0.29	NXA	complex4.pdb.gz	99,308,310
5	0.05	3ahnA	0.392	6.92	0.033	0.636	0.10	3A1	complex5.pdb.gz	156,157,160,261,303,306,308,311
6	0.01	1no3A	0.403	6.50	0.022	0.628	0.17	4NC	complex6.pdb.gz	170,171,211
7	0.01	2c6nA	0.367	6.54	0.040	0.584	0.23	LPR	complex7.pdb.gz	149,150,306,315
8	0.01	2oc2A	0.370	6.90	0.039	0.604	0.12	RX3	complex8.pdb.gz	157,158,239,306,308,311
9	0.01	1j36A	0.367	7.01	0.037	0.614	0.17	LPR	complex9.pdb.gz	153,156,157,160,317,331
10	0.01	2ivfA	0.371	7.10	0.036	0.631	0.25	SF4	complex10.pdb.gz	164,166,171,172,175,229,232

	Click on the radio buttons to visualize predicted binding site and residues.
(a)	Cscore^LB is the confidence score of predicted binding site. Cscore^LB values range in between [0-1]; where a higher score indicates a more reliable ligand-binding site prediction.
(b)	BS-score is a measure of local similarity (sequence & structure) between template binding site and predicted binding site in the query structure. Based on large scale benchmarking analysis, we have observed that a BS-score >1 reflects a significant local match between the predicted and template binding site.
(c)	TM-score is a measure of global structural similarity between query and template protein.
(d)	RMSD^a the RMSD between residues that are structurally aligned by TM-align.
(e)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(f)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

[Click result.zip to download all results on this page]

References:
1.	Wei Zheng, Qiqige Wuyun, Yang Li, Quancheng Liu, Xiaogen Zhou, Yiheng Zhu, P. Lydia Freddolino, Yang Zhang. Integrating deep learning potentials with I-TASSER for single- and multi-domain protein structure prediction. Submitted. 2023.