1dfm/1/1:B/1:A

Sequences

>1dfm-a1-m1-cB (length=213) [Search sequence]

KIDITDYNHADEILNPQLWKEIEETLLKPLHVKASDQASKVGSLIFDPVGTNQYIKDELV
PKHWKNNIPIPKRFDFLGTDIDFGKRDTLVEVQFSNYPFLLNNTVRSELFHKSNDIDEEG
KVAIIITKGHFPASNSSLYYEQAQNQLNSLAEYNVFDVPIRLVGLIEDFETDIDIVSTTY
ADKRYSRTITKRDTVKGKVIDTNTRKRGTIVTY

>1dfm-a1-m1-cA (length=218) [Search sequence]

Structure information

PDB ID	1dfm (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of restriction endonuclease BGLII complexed with DNA 16-mer
Assembly ID	1
Resolution	1.5Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	65
Sequence identity between the two chains	1.0
PubMed citation	10655616

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession	Q45488	Q45488
Species	1423 (Bacillus subtilis)	1423 (Bacillus subtilis)
Function annotation	BioLiP:1dfmB	BioLiP:1dfmA

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	1dfm-a1-m1-cB_1dfm-a1-m1-cA.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	1dfm-assembly1.cif.gz

Similar dimers