1e0e/1/1:A/1:B

Sequences
>1e0e-a1-m1-cA (length=46) [Search sequence]
FLEKIEPAQEEHEKYHSNVKELSHKFGIPNLVARQIVNSCAQCQQK
>1e0e-a1-m1-cB (length=46) [Search sequence]
FLEKIEPAQEEHEKYHSNVKELSHKFGIPNLVARQIVNSCAQCQQK
Structure information
PDB ID 1e0e (database links: RCSB PDB PDBe PDBj PDBsum)
Title N-terminal zinc-binding HHCC domain of HIV-2 integrase
Assembly ID 1
Resolution Not applicable
Method of structure determination SOLUTION NMR
Number of inter-chain contacts 10
Sequence identity between the two chains 1.0
PubMed citation 11101216
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession P04584 P04584
Species 11720 (Human immunodeficiency virus type 2 (ISOLATE ROD)) 11720 (Human immunodeficiency virus type 2 (ISOLATE ROD))
Function annotation BioLiP:1e0eA BioLiP:1e0eB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1e0e-a1-m1-cA_1e0e-a1-m1-cB.pdb.gz
Full biological assembly
Download: 1e0e-assembly1.cif.gz

[Back to Home]