1fj2/3/1:A/1:B

Sequences

>1fj2-a3-m1-cA (length=229) [Search sequence]

MDPEFMSTPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIKYICPHAPVRP
VTLNMNVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQ
GGALSLYTALTTQQKLAGVTALSCWLPLRASFPQGPIGGANRDISILQCHGDCDPLVPLM
FGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQEMMDVKQFIDKLLPPI

>1fj2-a3-m1-cB (length=229) [Search sequence]

Structure information

PDB ID	1fj2 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the human acyl protein thioesterase 1 at 1.5 A resolution
Assembly ID	3
Resolution	1.5Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	108
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	O75608	O75608
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	1fj2-a3-m1-cA_1fj2-a3-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	1fj2-assembly3.cif.gz