1gqm/1/1:C/1:D

Sequences
>1gqm-a1-m1-cC (length=87) [Search sequence]
TKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGL
DANQDEQVDFQEFISLVAIALKAAHYH
>1gqm-a1-m1-cD (length=87) [Search sequence]
TKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGL
DANQDEQVDFQEFISLVAIALKAAHYH
Structure information
PDB ID 1gqm (database links: RCSB PDB PDBe PDBj PDBsum)
Title The structure of S100A12 in a hexameric form and its proposed role in receptor signalling
Assembly ID 1
Resolution 2.7Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 91
Sequence identity between the two chains 1.0
PubMed citation 11856825
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C D
UniProt accession P80511 P80511
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:1gqmC BioLiP:1gqmD
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1gqm-a1-m1-cC_1gqm-a1-m1-cD.pdb.gz
Full biological assembly
Download: 1gqm-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1e8a/1/1:A/1:B 1gqm/1/1:A/1:B 1gqm/1/1:E/1:F 1gqm/2/1:G/1:H 1gqm/2/1:I/1:J 1gqm/2/1:L/1:K 1odb/1/1:C/1:D 1odb/2/1:F/1:E 1odb/3/1:A/1:B 2m9g/1/1:A/1:B
Other dimers with similar sequences but different poses
  • 1gqm/2/1:G/1:I 1gqm/1/1:A/1:D 1gqm/1/1:A/1:E 1gqm/1/1:C/1:B 1gqm/1/1:C/1:F 1gqm/1/1:D/1:E 1gqm/1/1:F/1:B 1gqm/2/1:G/1:K 1gqm/2/1:I/1:K 1gqm/2/1:J/1:H 1gqm/2/1:L/1:H 1gqm/2/1:L/1:J
  • 2wcb/1/1:B/1:A 2wc8/1/1:A/1:B 2wc8/2/1:C/1:D
  • 2wcf/3/1:F/1:E 2wce/1/1:A/1:B 2wcf/1/1:A/1:B
  • [Back to Home]