1gyy/1/1:A/1:B

Sequences
>1gyy-a1-m1-cA (length=76) [Search sequence]
PHIDIKCFPRELDEQQKAALAADITDVIIRHLNSKDSSISIALQQIQPESWQAIWDAEIA
PQMEALIKKPGYSMNA
>1gyy-a1-m1-cB (length=76) [Search sequence]
PHIDIKCFPRELDEQQKAALAADITDVIIRHLNSKDSSISIALQQIQPESWQAIWDAEIA
PQMEALIKKPGYSMNA
Structure information
PDB ID 1gyy (database links: RCSB PDB PDBe PDBj PDBsum)
Title The Crystal Structure of YdcE, a 4-Oxalocrotonate Tautomerase Homologue from Escherichia coli, Confirms the Structural Basis for Oligomer Diversity
Assembly ID 1
Resolution 1.35Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 126
Sequence identity between the two chains 1.0
PubMed citation 12356301
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession P31992 P31992
Species 562 (Escherichia coli) 562 (Escherichia coli)
Function annotation BioLiP:1gyyA BioLiP:1gyyB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1gyy-a1-m1-cA_1gyy-a1-m1-cB.pdb.gz
Full biological assembly
Download: 1gyy-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1gyj/1/1:A/1:B 1gyx/1/1:A/1:B

[Back to Home]