1h34/1/1:A/2:A

Sequences

>1h34-a1-m1-cA (length=57) [Search sequence]

KPCCDHCSCTKSIPPQCRCTDLRLDSCHSACKSCICTLSIPAQCVCDDIDDFCYEPC

>1h34-a1-m2-cA (length=57) [Search sequence]

KPCCDHCSCTKSIPPQCRCTDLRLDSCHSACKSCICTLSIPAQCVCDDIDDFCYEPC

Structure information

PDB ID	1h34 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of lima bean trypsin inhibitor
Assembly ID	1
Resolution	2.04Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	27
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	2
Chain ID	A	A
UniProt accession	P01056	P01056
Species	3884 (Phaseolus lunatus)	3884 (Phaseolus lunatus)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 1h34-a1-m1-cA_1h34-a1-m2-cA.pdb.gz

Full biological assembly Download: 1h34-assembly1.cif.gz