1h8p/1/1:A/2:B

Sequences
>1h8p-a1-m1-cA (length=88) [Search sequence]
EECVFPFVYRNRKHFDCTVHGSLFPWCSLDADYVGRWKYCAQRDYAKCVFPFIYGGKKYE
TCTKIGSMWMSWCSLSPNYDKDRAWKYC
>1h8p-a1-m2-cB (length=88) [Search sequence]
EECVFPFVYRNRKHFDCTVHGSLFPWCSLDADYVGRWKYCAQRDYAKCVFPFIYGGKKYE
TCTKIGSMWMSWCSLSPNYDKDRAWKYC
Structure information
PDB ID 1h8p (database links: RCSB PDB PDBe PDBj PDBsum)
Title Bull seminal plasma PDC-109 fibronectin type II module
Assembly ID 1
Resolution 1.82Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 21
Sequence identity between the two chains 1.0
PubMed citation 11937055
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A B
UniProt accession P02784 P02784
Species 9913 (Bos taurus) 9913 (Bos taurus)
Function annotation BioLiP:1h8pA BioLiP:1h8pB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 1h8p-a1-m1-cA_1h8p-a1-m2-cB.pdb.gz
Full biological assembly
Download: 1h8p-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 1h8p/1/2:A/2:B 1h8p/1/1:A/1:B
  • [Back to Home]