1hdf/1/2:A/2:B

Sequences
>1hdf-a1-m2-cA (length=99) [Search sequence]
SVCKGVSGNPAKGEVFLYKHVNFQGDSWKVTGNVYDFRSVSGLNDVVSSVKVGPNTKAFI
FKDDRFNGNFIRLEESSQVTDLTTRNLNDAISSIVATFE
>1hdf-a1-m2-cB (length=99) [Search sequence]
SVCKGVSGNPAKGEVFLYKHVNFQGDSWKVTGNVYDFRSVSGLNDVVSSVKVGPNTKAFI
FKDDRFNGNFIRLEESSQVTDLTTRNLNDAISSIVATFE
Structure information
PDB ID 1hdf (database links: RCSB PDB PDBe PDBj PDBsum)
Title Evolution of the eye lens beta-gamma-crystallin domain fold
Assembly ID 1
Resolution 2.35Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 11
Sequence identity between the two chains 1.0
PubMed citation 11250196
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID A B
UniProt accession P09353 P09353
Species 5791 (Physarum polycephalum) 5791 (Physarum polycephalum)
Function annotation BioLiP:1hdfA BioLiP:1hdfB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 1hdf-a1-m2-cA_1hdf-a1-m2-cB.pdb.gz
Full biological assembly
Download: 1hdf-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 1hdf/1/1:A/2:B 1hdf/1/1:B/2:A
  • [Back to Home]