1hg3/2/1:G/1:H

Sequences

>1hg3-a2-m1-cG (length=224) [Search sequence]

AKLKEPIIAINFKTYIEATGKRALEIAKAAEKVYKETGVTIVVAPQLVDLRMIAESVEIP
VFAQHIDPIKPGSHTGHVLPEAVKEAGAVGTLLNHSENRMILADLEAAIRRAEEVGLMTM
VCSNNPAVSAAVAALNPDYVAVEPPELIGTGIPVSKAKPEVITNTVELVKKVNPEVKVLC
GAGISTGEDVKKAIELGTVGVLLASGVTKAKDPEKAIWDLVSGI

>1hg3-a2-m1-cH (length=224) [Search sequence]

Structure information

PDB ID	1hg3 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of tetrameric TIM from Pyrococcus woesei.
Assembly ID	2
Resolution	2.7Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	146
Sequence identity between the two chains	1.0
PubMed citation	11243785

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	G	H
UniProt accession	P62003	P62003
Species	2262 (Pyrococcus woesei)	2262 (Pyrococcus woesei)
Function annotation	BioLiP:1hg3G	BioLiP:1hg3H

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	1hg3-a2-m1-cG_1hg3-a2-m1-cH.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	1hg3-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures	1hg3/1/1:A/1:B 1hg3/1/1:C/1:D 1hg3/2/1:E/1:F
Other dimers with similar sequences but different poses	1hg3/2/1:F/1:H 1hg3/1/1:A/1:C 1hg3/1/1:B/1:D 1hg3/2/1:E/1:G