1iuj/2/2:A/2:B

Sequences
>1iuj-a2-m2-cA (length=102) [Search sequence]
MFVTMNRIPVRPEYAEQFEEAFRQRARLVDRMPGFIRNLVLRPKNPGDPYVVMTLWESEE
AFRAWTESPAFKEGHARSGTLPKEAFLGPNRLEAFEVVLDSE
>1iuj-a2-m2-cB (length=103) [Search sequence]
MFVTMNRIPVRPEYAEQFEEAFRQRARLVDRMPGFIRNLVLRPKNPGDPYVVMTLWESEE
AFRAWTESPAFKEGHARSGTLPKEAFLGPNRLEAFEVVLDSEG
Structure information
PDB ID 1iuj (database links: RCSB PDB PDBe PDBj PDBsum)
Title The structure of TT1380 protein from thermus thermophilus
Assembly ID 2
Resolution 1.6Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 87
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID A B
UniProt accession P83693 P83693
Species 274 (Thermus thermophilus) 274 (Thermus thermophilus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 1iuj-a2-m2-cA_1iuj-a2-m2-cB.pdb.gz
Full biological assembly
Download: 1iuj-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1iuj/1/1:A/1:B 1iuj/2/1:A/1:B
Other dimers with similar sequences but different poses
  • 1iuj/2/1:A/2:B 1iuj/2/2:A/1:B
  • [Back to Home]