1j1y/1/1:B/2:B

Sequences
>1j1y-a1-m1-cB (length=115) [Search sequence]
DPFMEALGLKVLHLAPGEAVVAGEVRADHLNLHGTAHGGFLYALADSAFALASNTRGPAV
ALSCRMDYFRPLGAGARVEARAVEVNLSRRTATYRVEVVSEGKLVALFTGTVFRL
>1j1y-a1-m2-cB (length=115) [Search sequence]
DPFMEALGLKVLHLAPGEAVVAGEVRADHLNLHGTAHGGFLYALADSAFALASNTRGPAV
ALSCRMDYFRPLGAGARVEARAVEVNLSRRTATYRVEVVSEGKLVALFTGTVFRL
Structure information
PDB ID 1j1y (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of PaaI from Thermus thermophilus HB8
Assembly ID 1
Resolution 1.7Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 111
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID B B
UniProt accession Q5SJP3 Q5SJP3
Species 300852 (Thermus thermophilus HB8) 300852 (Thermus thermophilus HB8)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 1j1y-a1-m1-cB_1j1y-a1-m2-cB.pdb.gz
Full biological assembly
Download: 1j1y-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1j1y/1/1:A/2:A 1wlu/1/1:A/3:A 1wlu/1/2:A/4:A 1wlv/1/1:C/1:A 1wlv/1/1:D/1:B 1wlv/2/1:E/1:G 1wlv/2/1:F/1:H 1wm6/1/1:A/1:C 1wm6/1/1:B/1:D 1wm6/2/1:E/1:G 1wm6/2/1:H/1:F 1wn3/1/1:B/1:D 1wn3/1/1:C/1:A 1wn3/2/1:E/1:G 1wn3/2/1:F/1:H 2dsl/1/1:A/2:A 2dsl/1/1:B/2:B
Other dimers with similar sequences but different poses
  • 1wlv/1/1:C/1:D 1j1y/1/1:B/1:A 1j1y/1/2:B/2:A 1wlu/1/1:A/4:A 1wlu/1/2:A/3:A 1wlv/1/1:B/1:A 1wlv/2/1:E/1:F 1wlv/2/1:G/1:H 1wm6/1/1:B/1:A 1wm6/1/1:C/1:D 1wm6/2/1:E/1:F 1wm6/2/1:G/1:H 1wn3/1/1:A/1:B 1wn3/1/1:C/1:D 1wn3/2/1:E/1:F 1wn3/2/1:G/1:H 2dsl/1/1:A/1:B 2dsl/1/2:A/2:B
  • 1wlv/1/1:C/1:B 1j1y/1/1:B/2:A 1j1y/1/2:B/1:A 1wlu/1/1:A/2:A 1wlu/1/3:A/4:A 1wlv/1/1:D/1:A 1wlv/2/1:E/1:H 1wlv/2/1:F/1:G 1wm6/1/1:A/1:D 1wm6/1/1:B/1:C 1wm6/2/1:E/1:H 1wm6/2/1:G/1:F 1wn3/1/1:A/1:D 1wn3/1/1:C/1:B 1wn3/2/1:E/1:H 1wn3/2/1:G/1:F 2dsl/1/1:A/2:B 2dsl/1/1:B/2:A
    		•

    [Back to Home]